KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_123896Help
Entry
BRAFLDRAFT_123896 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 449 aa AA seqDB search
MATAEQTGSVVRENVQEMNHSLPETVQLNLQKDLKPTEENGNDHIPEISETYSVRRSDGT
WHDAEVIQTRRNEHEGGRMEFYVHYKGFNRRLDEWVDLCRIDVQSHSSRKKRAAEETLYD
FADQPDRKITRNQKRRHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKVQIGKYEI
DAWYFSPFPEDYGKCPRLYICEFCLKYMKYEKTYRHHMGECTFRQPPGKEIYRKGTISVY
EVDGRGDKIYCQNLCLLAKLFLDHKTLYFDVEPFMFYILTEVDKQGAHLVGYFSKEKESP
DGNNLACIMTVPPFQRKGYGKFLIAFSYELSKLEHRVGSPEKPLSDLGKLSYRSYWSWVL
LEILRDFKGTLSIKDLSQMTSITENDIISTLQSMNMVKYWKGQHVICVTAKLVEEHLKSA
QYRRPPIMVDTSCLRWAAPKKKDVKISKK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggctacggcggagcagacgggtagtgttgtccgagaaaatgtccaagaaatgaaccat
tctctacccgaaacggttcagctgaaccttcaaaaggatctcaagccgaccgaggaaaac
gggaacgaccacattcccgagatcagcgagacgtacagtgtcagacgatcggatggcacg
tggcatgatgcagaagttatccagaccaggcggaatgaacacgagggaggacgaatggag
ttctatgttcattacaaaggatttaacagacgtctggatgagtgggtggacctgtgcagg
atcgatgttcagtctcacagcagtaggaagaaacgggctgcagaagaaactctgtacgac
ttcgcagaccaaccggacagaaagatcacacgcaaccagaagagacggcacgatgaaatc
aatcacgtgcagaagacttatgcagagatggacccaaccaccgcagcacttgaaaaggaa
catgaagctatcacaaaagtgaagtacgtagacaaggtccagattgggaagtacgaaatc
gatgcctggtacttctcgccattcccagaggactatgggaagtgtccacggctgtacatt
tgcgaattctgcctgaaatacatgaagtatgagaagacatacagacatcacatgggagag
tgcacattccgccagccgccagggaaagagatctacaggaaggggacgatctctgtatat
gaagtggacgggcgaggagacaaaatctactgtcagaacctgtgtctgctagccaaactg
ttcctggaccacaagaccctgtactttgatgtggaacccttcatgttctacatcctcaca
gaggtggacaaacaaggagcgcatctggtgggatatttctccaaggagaaagaatcccca
gatggcaacaacctggcctgcatcatgaccgtgccgccattccagaggaaaggctacggg
aagttcctcatcgcattcagttatgagttgtccaaactggaacacagagttggttcccca
gagaagccgctgtcggacctggggaagctgagctaccgcagctactggtcctgggtattg
ttagagatcctcagggacttcaagggaacactctccattaaagacttgagccagatgacc
agcatcacggagaatgacatcatctccaccctgcagtccatgaacatggtgaagtactgg
aagggtcagcacgtcatctgtgtcacggccaaattggtggaggagcacctgaagagcgca
cagtaccgccgaccgcccatcatggtcgacacgtcctgtctgcgatgggcggcaccaaaa
aagaaagatgtcaaaatatcaaagaagtga

DBGET integrated database retrieval system