KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_124315Help
Entry
BRAFLDRAFT_124315 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bfo00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bfo00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 871 aa AA seqDB search
MRDTPGQSPSILPTFLLSSLGYFISISSGRWSSCFSLWSQKLDQEGEFNRPKMGTRQELL
SGPDVRKLEKLFQHGTGVPDQGWRIPLDHVFPRRGMKPNAKPRFKQLKDLYGVFYRYFFW
WMKKKTGHKRPFIDALNPVQLQQIYGVPLGGLGCGSICRGWKGDFCRWALLPGIYSYDIK
MANQFTVCVRRRGQTTYQQVLSTRHPSCLTEWNWSYSPSHAYYHALYPRAWTVYELPGQN
ITLTCRQVSPVLPHDYKDSSIPAAVFVWTAENHGKEEVDISLMFTFQNSIGADTDLSGGH
WNEPFSVNEEGVDPVSGILLHHQHKTMPCTIALGIPHKEGIRVTGSTSFNPAGSGKEIWR
DLMYDGELGSPEAPTNKTVKGEALAGAVCASFKLPSGGKQDTDFVLSWDMPVIKFVGSCR
TYKRWYTGWFGDDGTAAPKLAAYALSHYPEWESTIEEWQRPILDNQSYPEWYRSALFNEL
YFMSDGGTIWLVAEDNDGHVENNLPPWLREKTPAHIMEYGRFGYLEGHEYRMYNTYDVHH
YASFALAMLWPQLEYSIQYDYDDEPFIHVNAYVMHDTSDWRDLNLKFVLQIFRDYFVGRD
KGFLAFMWPRAQAVMTKALTWDTDQDGMIDNSGAADQTYDAWIVTGASAYCGGLWLAALR
CMVEIANILGKEEEEQHYLAVMQRAKTAYEEKLWNGEYYNYDCSGRSYSNSIMAGAGSGH
WYLRACGLVPEDNEVMDSDREVLPLDHVASSLRKVYDFNVMQFHQGTMGAVNGMRPNGKK
DLTSMQSEEVWTGITYALAASMIQEGMVEEGFQTAYGVYNMCYLQCGFAFQTPEAYLERD
FFRSLGYMRPLAIWAMQWALESRHRARVTSS
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgagagacacgccaggtcagagccccagcattctgccgacgtttctgctgtctagcctt
gggtatttcatctctatttcttccggacgctggtccagctgcttcagtttgtggtcacaa
aagctcgatcaagaaggcgagtttaatcgtccaaaaatgggcacccgacaggagctgttg
tcaggcccagacgtgcgcaagttggagaagcttttccagcacggaaccggcgttcctgac
cagggctggagaatccccctggaccatgtgtttccacggaggggtatgaagcccaatgcc
aaacctcgcttcaagcaactcaaagatctgtacggagtgttctataggtactttttctgg
tggatgaagaagaaaactggacataagagaccattcattgatgccctgaatcctgtgcag
cttcaacaaatctatggtgtgccactagggggtctcggctgtggtagtatctgccgcgga
tggaagggtgacttttgtagatgggcactgctacctgggatctacagctatgacatcaaa
atggccaaccagtttactgtgtgtgtcaggagaagaggccagacaacctatcagcaggtt
ttatccaccagacatccatcatgtctgacggagtggaactggagctacagcccgtcccat
gcctattaccacgccctgtacccccgtgcctggacagtgtacgagttacctggacaaaac
atcactctcacctgtcggcaggtgtcacctgtgcttccacatgactacaaggacagcagc
atccctgcagctgtgtttgtctggacagcagagaatcatgggaaggaagaagtggacatc
agcctcatgttcaccttccagaattccataggagctgatactgacctctcaggaggtcac
tggaatgaaccattttctgtgaatgaggaaggagtcgaccctgtatctgggattttgctg
catcaccagcataagacgatgccttgcacaattgccttaggaataccacataaggagggc
atccgagtgacaggtagcacatcgtttaacccagctggttctgggaaggagatctggagg
gacctgatgtacgatggagagctggggtcaccagaagcccctacaaacaagacagttaaa
ggggaagccctggccggagcagtctgtgcatcatttaagctgccatcaggaggaaaacag
gacactgattttgtcctgtcctgggacatgcctgtcataaagttcgttgggtcctgtcgc
acctacaagaggtggtatacaggctggttcggggatgatggaacagctgcccccaaactt
gctgcctatgctctcagtcactacccagagtgggagagcaccatagaggagtggcagagg
cctatcctggacaatcagtcctacccagagtggtataggtctgccctgttcaatgagttg
tacttcatgtctgatggtgggaccatctggttagtggctgaggacaatgatggacatgtg
gagaacaatctgccaccatggctcagggagaagactcctgctcacatcatggagtatggg
aggtttggctatttggaaggccatgagtacagaatgtacaacacctatgatgttcaccac
tatgcatcctttgccttagcaatgctgtggcctcagttggaatacagcatccaatatgac
tatgatgatgagccattcatccacgtcaatgcctatgtgatgcatgacacgtctgactgg
agggatctgaacctgaagtttgtgttacaaatcttcagggactactttgttggacgtgat
aagggcttcctagctttcatgtggccaagagcccaggctgttatgaccaaagcccttaca
tgggacacagaccaggatgggatgatagacaacagtggggcagctgaccagacttatgat
gcctggattgtaactggagcaagtgcctactgtggtggactgtggttagctgccctgagg
tgtatggtggagatagctaacatcctggggaaggaggaggaagaacaacactacttggca
gtcatgcagagggccaaaactgcctatgaggagaaactctggaatggggagtactacaac
tatgactgcagcggtagatcctactccaactccatcatggcaggggcagggtcaggacac
tggtacctccgggcctgtggactggtacccgaggacaatgaagtcatggactctgatagg
gaggtcctgcctttggaccatgtcgcaagttcgctgaggaaagtgtatgacttcaacgtg
atgcagttccaccagggcactatgggagctgtcaacgggatgcggcctaacgggaagaaa
gacctgaccagtatgcagagtgaggaagtttggacgggaatcacatatgcactagcagcc
agtatgatccaggagggcatggtggaggagggtttccaaacagcctatggtgtgtacaac
atgtgttacctccagtgtggcttcgccttccaaactcctgaagcttacctggagagagat
tttttccgctccctgggctacatgcgtcccctggccatctgggccatgcagtgggcccta
gagagcaggcacagggcaagggtcactagtagctaa

DBGET integrated database retrieval system