KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_124326Help
Entry
BRAFLDRAFT_124326 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
bfo04140  Autophagy - animal
bfo04150  mTOR signaling pathway
Module
bfo_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_124326
   04150 mTOR signaling pathway
    BRAFLDRAFT_124326
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    BRAFLDRAFT_124326
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     BRAFLDRAFT_124326
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: STE group
  STE7 family
   BRAFLDRAFT_124326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 7244120
NCBI-ProteinID: XP_002601633
JGI: 124326
UniProt: C3YQ07
AA seq 459 aa AA seqDB search
MADAKAAKRKRDLNKLGLTIATPADEQNAGKSDTSTTKQEVKEQASEVVPRKKVGKGSAQ
AGSSAKGQQRVSVVIKQTAEQKSNYDALQKKLEELELDDQQRKRLEAFLTQKEQVGELNA
EDLEKLGELGAGNGGVVTKVKHKPSGLIMARKLIHLEIKPAIRNQIIRELKVLHECNSPH
IVGFYGAFYSDGEISICMEYMDGGSLDLILKKAGKIHEKILGKISIAVLKGLTYLREKHQ
IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSD
IWSMGLSLVEMAVGRYPIPPPEPKDMAAIFDVPPESLDPDYAASSSSPSQAGRPAGRPLS
NTFNMPHPGGDGPRPMAIFELLDYIVNESPPKLPRKIFTDKFIDFVDKCLVKNPAERADL
KQLMVHPFIKRSESEDVDFAGWVCKTMNLQPRTPTHTTV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcaaaggcggcgaagaggaagagggacttgaacaagctggggttaacgatc
gctaccccggcagacgagcagaacgctggaaaatcggatacaagtacaaccaagcaggaa
gtaaaagagcaggcaagtgaggttgtcccaagaaaaaaagtaggtaagggctctgcccag
gccggcagctctgccaaaggacaacaacgagtgtcagtggtcattaagcaaactgctgaa
caaaaaagcaactatgatgctctgcagaagaagctggaagagcttgagctggatgatcag
cagagaaaaaggctggaagcattcttaacacagaaagagcaagtaggggagctgaatgca
gaggacttggagaagctgggcgagctgggtgcaggcaacgggggtgtggtcacaaaagta
aaacacaaaccctccgggcttattatggcaaggaagcttatccacctggagattaagcca
gccattaggaaccagatcattcgggaactgaaggtcttacacgaatgtaactcgcctcac
atcgtgggcttctatggtgctttctacagtgatggggagatcagtatctgtatggaatac
atggatggaggttcgttggacttgattctgaagaaggcagggaagattcatgaaaaaatt
ttaggcaagattagtattgctgttttaaagggtttgacatatttacgggagaagcaccaa
atcatgcacagagatgtgaagccctccaacatccttgtcaactctcggggagagattaaa
ctgtgtgactttggtgtcagtgggcagctcatagactccatggctaattcttttgtggga
accaggtcctacatgtcgccagagagactgcagggaacgcattactctgtacagtcagac
atctggagtatgggtttgtccttagtagagatggctgtggggcgctaccccatcccaccc
cctgaacctaaggacatggcagccatttttgatgtacccccagagtccttggacccagac
tatgctgcatccagcagttctccctcacaagcaggcagaccagcgggcaggcctctcagt
aacacattcaatatgccccaccctggtggggatgggccccgacctatggccatctttgaa
ctcttggactacattgttaatgagtctcctcccaaactcccaagaaagatcttcacagac
aagttcattgactttgtagataagtgcttggtgaaaaacccagcagaaagagcagattta
aaacagttgatggttcacccatttatcaagaggtcagagtcagaagatgtggactttgcc
ggttgggtttgtaaaactatgaacctccaaccgcgtacccctacgcacaccacagtatag

DBGET integrated database retrieval system