KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_124425Help
Entry
BRAFLDRAFT_124425 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    BRAFLDRAFT_124425
   04142 Lysosome
    BRAFLDRAFT_124425
Exosome [BR:bfo04147]
 Exosomal proteins
  Proteins found in most exosomes
   BRAFLDRAFT_124425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1533 aa AA seqDB search
MAQILPIRFQEHLQLQNVGVNAANIGFSTLTMESDKFICVREKVGDQAQVVIIDLADAAN
PIRRPISADSAIMNPASKVIALKGSGSAGKTLQIFNIEMKSKMKAHNMVEDVTFWKWITV
NTIALVTETAVYHWAMEGDSQPQKMFDRHSSLAGCQIINYRTDAAQKWLLLIGISAQQNR
VVGAMQLYSVDRKVSQPIEGHAAAFGQFKMEGNSEQSTLFCFGVRGAQGGKLHIIEVGQA
PSGNQPFTKKAVDVFFPPEAQNDFPVAMQVSSKHDVIFLVTKYGYIHLYDLESGVCIYMN
RISGDTIFVTAPHEATSGVIGVNRKGQVLSVSVEEDNIIPYITNVLQNPDLALRMAVRNN
LAGAEDLFVRKFNTLFSQGNYSESAKVAANAPKGILRTPQTIQRFQQVPAQAGQTSPLLQ
YFGILLDHGQLNKYESLELCRPVLQQGRKQLLEKWLKEEKLECSEELGDLVKTSDPTLAL
SVYLRANVPNKVIQCFAETGQFQKIILYAKKVGYTPDYIFLLRNVMRINPDQGLQFAQMM
VQDEEPMADINQIVDVFMEMNLVQQCTSFLLDALKNNRPSEGALQTRLLEMNLMSAPQVA
DAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAIVHTHLLNPDWLVNFFG
SLSVEDSLECLKAMLQNNIRQNLQIAVQVATKYHEQLTTQSLIDLFESFKSYEGLFYFLG
SIVNFSQEAEVHFKYIQAACKTGQIKEVERICRESNCYDPEKVKNFLKEAKLTDQLPLII
VCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPARLPVVIGGLLDVDCGEDVIKNLIMVV
RGQFSTDELVAEVEKRNRLKLLLPWLESRIHDGQTEPATHNALAKIYIDANNNPERFLRE
NPYYDSKVVGKYCEKRDPHLACVAYERGQCDQELIQVCNENSLFKSEARYLVKRRDPELW
ATVLIETNEYRRQLIDQVVQTALSETQDPEDISVTVKAFMTADLPNELIELLEKIVLENS
VFSDHRNLQNLLILTAIKADRTRVMEYITRLDNYDAPDIANIAIGSELYEEAFAIFKKFD
VNTSAIQVLIHNISNLDRAYEFAERCNEPGVWSQLAQAQLQQGMVKEAIDSYIKADDPSQ
YMEVVDVANKNGNFEDLVRYLQMARKKSREAYVETELIFAYAQTNRLAELEEFISGPNTA
NIQQVGDRCYDAKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDSARKANSTRTWKEV
CFSCVDGEEFRLAQMCGLHIVVHADELEDLINYYQDRGYFEELIQLLEAALGLERAHMGM
FTELAILYSKYKPQKMREHLELFWSRVNIPKRLEKHELIEFRRISAYLFKGNNRWKQAVE
LCKRDKLFKDALEYAAESRDTETAEELIAWFLEQKNHECFAATLYTCYDLLRPDVILELS
WRHNILDFAMPFFVNVMREYISKVDKLIESEEQRKEEETTTQQPIVYGEPQLMITSGPQI
GVPPQQMPPGMVPGMMPGAAPMPGGYQAPYASM
NT seq 4602 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagattctgcccatccgcttccaggagcacctccagcttcaaaatgttggcgtc
aacgcagcgaatatcgggttcagcaccctcaccatggagtccgacaagttcatctgcgtg
cgggagaaagttggcgaccaggcgcaggtggtcatcatcgacctggctgacgcggccaac
cccattcgccgacccatctccgcagactccgccatcatgaaccccgccagcaaggtcatt
gctttgaaaggcagcggcagtgctggaaagactctgcagatcttcaacattgagatgaag
agtaagatgaaggcccacaacatggtggaggatgtgaccttctggaagtggataactgtc
aacaccatcgccctggtaactgagacggctgtgtaccattgggccatggaaggtgactcg
cagccgcagaagatgtttgaccgccattccagcttggccgggtgccagatcatcaactac
cgcacggacgcagcgcagaagtggcttcttctcatcggcatctcggcacagcaaaacaga
gttgttggtgccatgcagctgtactctgtggaccgtaaggtcagccagccaatcgaaggc
cacgcagcggcgttcggtcagttcaagatggaaggtaactccgaacagtccacgctgttc
tgcttcggagtccggggcgcccagggtgggaagctacatatcattgaggtgggacaggcg
ccttctgggaaccaaccattcaccaagaaggcagtggacgttttcttccctccagaagca
cagaatgacttccctgtggccatgcaggtgagctctaagcatgacgtcatcttccttgtg
accaaatatggctacatccatctgtacgacttggagagcggtgtctgcatctacatgaac
cggatcagtggagacaccatctttgtcaccgcgccccacgaggccaccagcggtgtcatc
ggagtcaaccgtaaaggacaggtcctgtctgtgagtgtggaggaggacaacatcatcccc
tacatcaccaacgtgctgcagaaccctgacctggcactgcgcatggccgtcaggaacaac
ctggccggcgccgaggacctcttcgtgcgcaagttcaacactctgttctcccagggcaac
tactcggagtccgctaaggtcgcagctaacgcaccaaaggggatcctgcgtaccccccag
acgatccagcgtttccagcaggtcccagcgcaggctggccagacgtccccactgctgcag
tacttcggcatcctgctggaccacgggcagctcaacaagtacgagtccctggagctgtgc
cgccccgtcctgcagcaaggcaggaaacagctgctggagaaatggctcaaggaggaaaag
cttgagtgtagcgaggagcttggagatctagtcaagacgagcgaccccacactagcactc
tccgtctaccttcgcgccaacgtgcccaacaaggtcatccagtgttttgcggagaccggg
cagttccagaagatcatcctgtacgccaagaaggttggctacaccccggactacatcttc
ctgctgcgtaacgtgatgcgcatcaaccccgaccagggcctgcagtttgcacagatgatg
gtgcaagacgaggaaccaatggctgacatcaaccagattgttgatgtgtttatggagatg
aacctggtgcagcagtgcacatccttcctcctggatgcgctgaagaacaaccgtccgtca
gagggcgcgctccagacacgcctgctggagatgaacctcatgtctgctccccaggtggca
gacgctatcctcgggaaccagatgttcacgcactacgaccgcgcccacatcgcccagctg
tgcgagaaggcggggctcctgcagcgtgcgctcgagcactacaccgacctgtacgacatc
aagcgtgcaattgtgcacacccacctgctcaaccctgattggctggtcaacttcttcggc
tctctgtccgtggaagattcgctggaatgtctgaaggccatgcttcagaacaatatccga
cagaacctacagatcgccgtgcaggtggccacaaagtaccatgaacagctgaccacccag
tccctcattgacttgttcgagtccttcaagagctacgaggggctgttctacttcctgggc
tccatcgtcaacttcagccaggaagctgaggtccacttcaagtacatccaggctgcctgc
aagactggtcagatcaaggaggttgaacgtatctgccgcgagagcaactgttacgatcca
gagaaggtcaagaacttcctgaaggaagccaaactgacagaccagctcccactgatcatc
gtgtgcgaccgattcgactttgtgcacgacctggtcctgtacctgtaccgcaacaaccta
cagaagtacatcgagatctatgtacagaaggtgaaccctgcgcgtttgcctgttgttatc
ggaggcctgctggacgtggactgtggggaggacgtaatcaagaacctcatcatggttgta
cgtgggcaattctccactgacgagctggtcgctgaggtggagaagagaaacaggttgaag
cttctgctgccgtggctggaaagtcgtatccacgatgggcagaccgagcctgccacccac
aatgcactggccaagatctacattgacgccaacaacaaccctgagaggttcctgagggag
aacccgtactatgacagtaaggtcgtgggcaagtactgtgagaagcgggacccacacctc
gcatgtgtggcctacgaaagggggcagtgtgatcaggaactcattcaggtgtgcaatgag
aactccctgttcaagagcgaggcacgttacctggtgaagcggcgcgaccctgagctgtgg
gccacggtgctgattgaaaccaacgagtaccgcaggcagctcatcgaccaggtggtgcag
acggcactatcagagacccaggacccagaagacatctctgtgaccgtgaaggccttcatg
accgcggacctgcccaacgaactgatcgagctactggagaagattgttctcgagaactcg
gtcttctcggaccacaggaacctacagaacttgttgatcctgacggctatcaaggctgac
cgcacgcgtgtcatggagtacatcacccgcctggacaactacgacgctcctgacatcgcc
aacattgccattggctcggagctgtacgaggaagctttcgccatcttcaagaagtttgac
gtcaacacttctgctatccaggtgttgatccacaacatcagtaacctggaccgtgcgtac
gagtttgcggagcgctgtaacgagccgggcgtgtggagccagctggctcaggcccagctg
cagcaggggatggtgaaggaggccatcgactcctacatcaaggctgacgacccctcccag
tacatggaggtggtggatgtggcaaataagaacggaaacttcgaggacctcgtgcggtac
ctgcagatggcgaggaagaagtcgcgtgaagcgtacgtggagacagagctgatcttcgcc
tacgcccagaccaacaggctggccgaactggaggagttcatctccggccccaacaccgcc
aacatccaacaggtcggcgacaggtgctatgacgcaaagatgtatgatgcggccaaactg
ctgtacaacaacgtgtccaactttgggcgtctggcctccaccctggtccacctgggcgag
taccaggccgccgtggacagcgcccgcaaggccaacagcacgcgcacgtggaaggaggtg
tgcttctcgtgtgtggacggcgaggagttccgtctggcgcagatgtgtggtctgcacatc
gtggtgcacgctgacgagctggaggatctcatcaactactaccaggacagaggatatttt
gaggaactgatccagctgctggaggctgccctgggcctggagcgtgctcacatgggcatg
ttcacggagctggccatcctctactccaagtacaagccacagaagatgagggaacatctg
gagctcttctggtcacgtgtcaacattccaaagaggttggaaaagcacgagctgatcgag
ttccggcggatatcagcgtacctgttcaagggcaacaaccgctggaagcaggcagtcgaa
ctgtgcaagagagacaagctcttcaaggatgccctggaatacgcagccgagtcgcgggac
acggaaacggcagaagagctgatcgcctggttcttggaacagaagaaccacgagtgcttt
gcggcaaccctgtacacctgctatgacctgttacggccagacgtcatcctagagctgtcc
tggaggcataacatcctggactttgccatgccattcttcgtcaatgttatgcgggaatac
atttcaaaggttgacaaattaatagaatcagaggaacagaggaaagaagaagaaaccaca
acacaacagccaatagtctatggtgaaccccagttgatgatcacatctggtcctcagatt
ggtgtcccccctcagcagatgcccccaggaatggtacccggcatgatgccaggtgccgca
cccatgccaggtggctaccaggcaccttacgcctccatgtga

DBGET integrated database retrieval system