KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_124584Help
Entry
BRAFLDRAFT_124584 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BRAFLDRAFT_124584
   00240 Pyrimidine metabolism
    BRAFLDRAFT_124584
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BRAFLDRAFT_124584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 255 aa AA seqDB search
MATEAKKARLNRIKRVAVEGNIAVGKSTFISLLEEESSDWAIVGEPLSRWQNVQCHSEKE
EEITLSQKHGGNLLDMFYSDPRRWAFTFQSYVCLSRMRHQLKPAPGHLETAAEPVVFYER
SVYSDRYWADAKVRFLWVIGYRSGWNIYCDWHSTMMAAMGELKLDGIIYLRAEPEVCLER
LKLRGRPEERPVSLEYLDQIHTRHESWLVHKEISVSDSLKGAPILTMDCNLSFQEDTDKQ
KDMMSQVGQQQVYIL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaagcgaagaaagctcgtctgaaccggatcaaaagggtcgctgtggagggg
aatatcgcggtggggaagtcgaccttcatctccctgctggaggaggagagctctgattgg
gcgatcgtcggcgagccgctgtcccgctggcagaacgtgcagtgccacagcgagaaggag
gaggaaatcaccctgtcccagaagcacggagggaacctgctggacatgttctactccgac
cctcgccgctgggcgttcactttccagtcgtacgtctgcctgagccgtatgaggcaccag
ctcaaaccggcaccgggccacctcgaaactgccgccgaacccgtcgtcttctatgagcgc
tccgtctacagtgacaggtactgggctgatgccaaggtgaggtttctctgggttataggt
tatcggtcagggtggaacatctactgtgactggcactccaccatgatggcagccatgggt
gagctgaaactggacgggatcatctacctcagggctgagccagaggtgtgtctggagaga
cttaagctgcgaggccggcctgaggagcgtcctgtctctctggagtatctggatcagatc
cacacccgacacgagtcctggctggtgcataaggagatcagtgtttcagacagtctcaag
ggggcgccgatcctgaccatggactgtaacctgagtttccaggaagacacggacaaacag
aaggacatgatgtcacaggtgggtcaacaacaggtttacattctgtag

DBGET integrated database retrieval system