KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_124685Help
Entry
BRAFLDRAFT_124685 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BRAFLDRAFT_124685
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     BRAFLDRAFT_124685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 863 aa AA seqDB search
MNKMGLNTYLYAPKDDYKHRAYWRDLYSVEEAEHLTSLIAEASESSVTFVYALSPGLDIT
FSSAKDVTFLKRKLEQVSHFGCKAFALLFDDIETDMCIADKEVFQSFAHAQVSVTNEVYQ
HLGQPTFLFCPTEYCESRAVPDIETSQYLTTVGSKLLPDIDVLWTGPRVVSKIISVEHIQ
KVTKTIKRPPVIWDNIHANDYDHKRVFLGPYDGRSTALMPHLHGVLTNPNCEFESNFMAL
HTLATWSKSTVDVTKKEAEGGDNSAVTSDIKLETEGVTEDSTTKSEGGLYNRNAALKLAL
KDWLEVIKTPKSGGMGVIKRSGNVSVITDSVTTVNTCMTMTPTTTSSCTQPVMCPVNTLT
GEPIDIPKLPSSPSTDSAFDSTSASSESKDSEEGEGLEPMDISSSPAVSSPPTSSLLSSE
STSCKQVGGDVGKKVEDTQPSTSTAIEGKVPETETMQVDYEGVDMSPPNPLEMQTDTEEI
KSRINPLYTAQPVTYDDLAMLVDLFFLPFEHGPFGVHLIEEFIWLKTNSRIVSKCKRTLR
STAEDVKEWHERSEKYDKSCQSVLDMVNRLLNAPNRAAVYELFPYIYELKGIVALLKSFV
KWLGSNRGYKDAFLTGKEEPWVFRGGLTGELQRLLPIDGAGDLFHQRAPDSPQSSIYIIR
PYLHPDQDDVYEVCRKTCDDGLDGTDVFPDHPALIGDKLVGSFLTLSPEFCFVALDASEK
VCGYVVAALDAKDFYKKFEVAWLTDLCNKYPKPTAEGNLSPAEEIINSFHNYKVYLPPNL
YKRFPSLLRMSLLPQFLMDDPGVAKNMMACLFAALKANGSSGVYCEVNIGDKRMLEFYTK
MGFFDVPMLDEYSEEVLILGRSF
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatgggactaaacacatacctgtatgcgcccaaggacgactacaaacacaga
gcctattggcgggatctttactctgtagaggaagcagaacaccttacaagtctgatagca
gaagccagtgaaagtagtgtgacttttgtttatgcactttcacctggtctggacatcacc
ttctccagtgcaaaagatgttacctttctcaagaggaaactggaacaggttagccatttt
ggatgcaaggcctttgcgctgctttttgatgacatagagacagacatgtgcattgctgac
aaggaagtgttccagtccttcgctcatgcacaagtttctgtcacaaacgaagtgtaccag
caccttggacaaccaacattcctcttctgtccaacagaatattgtgagtccagagcagtg
ccagacatcgagacctcacaatacctcacaactgttggctccaagcttctccccgacata
gatgtcctatggaccggaccaagggtagtatcgaagatcatcagtgttgaacatatccag
aaagtgaccaaaacaatcaagaggcctccagttatttgggacaacatccatgccaacgac
tatgaccacaagcgcgtcttcttgggaccatacgacggtcgttccactgcactgatgcca
cacttgcacggggtcttaaccaatccaaactgtgagtttgagagtaacttcatggccctc
cacacgctggcgacttggagcaaaagcacagtcgatgtgaccaaaaaggaggcagagggt
ggggacaacagtgcagtcacctcagacatcaaactggagacagagggcgtcacggaagac
tccactacaaaatctgaaggaggattatacaacagaaatgcagctctaaaactggcactc
aaggactggctggaggtgatcaaaacacctaagagcggtgggatgggcgtgataaaaaga
agtggaaatgtcagtgtcataacagactctgtcacaacagtaaacacgtgcatgaccatg
acgcccacaaccaccagcagttgcactcaacccgtgatgtgtccagtcaataccctgact
ggggagcccatagacattccaaaactgccatccagtccttctacagactctgccttcgac
tcaacatcggccagctcagaatccaaggactctgaggaaggggagggtttggagcctatg
gatatctcctcttcacctgcagtctcttctcctcccacatcaagcctgctgtcatctgaa
agtacatcatgtaagcaagtagggggagatgttggaaagaaagttgaagacacacagcct
agcacaagcaccgcaatagagggaaaggtgcctgaaacagagacgatgcaggttgactat
gaaggggtggacatgagtccacctaatcctttggaaatgcaaactgacacagaagaaatc
aaatcaagaataaaccccctctacacagcacaacctgtgacgtatgatgacttggcaatg
ttggtggacttgttctttctcccgtttgagcatggtccatttggtgtccacctgatagag
gagtttatctggctgaagacaaattccagaattgtgagcaagtgcaagagaacactaagg
tcaacagctgaggacgtgaaagaatggcatgaaagatcagagaagtatgacaagagctgc
caaagtgtgctggacatggtcaaccgtctgctgaatgcacccaacagagctgctgtctac
gaactcttcccttacatctatgaactgaagggcatagtagcccttctgaagtcttttgtc
aagtggcttgggagtaatagaggttataaggatgcctttttgactggcaaagaagagcca
tgggtgttccgaggaggtctgacaggcgaattacagagattattgcccatcgatggtgca
ggggacttgttccaccagagagcaccggactcccctcagtcctctatctacatcatacgc
ccatatttgcatcctgatcaggacgacgtgtatgaggtctgcagaaaaacttgtgatgac
gggctggatggaacagacgtgtttccagatcatccggccctcattggagacaaactggtg
ggatcattcctgaccctgagccctgagttctgcttcgtggctctggatgccagtgagaag
gtgtgtggttatgttgtggctgccctggacgcaaaggacttctacaagaagtttgaggtg
gcctggttgactgatctctgcaacaagtacccaaaacccacggcagaagggaatctgtcc
cctgctgaggagatcatcaacagtttccacaactacaaggtgtacctgcctccaaacctg
tacaagaggttcccatccttgctgaggatgagtctgctacctcagttcctaatggatgat
cctggtgtggcaaagaacatgatggcttgtctgtttgctgcactgaaggcaaatgggtcc
agtggtgtgtactgtgaagtcaacattggagacaaacgcatgctggaattttacacaaag
atgggcttcttcgatgtccccatgctggacgaatactccgaggaagttctcatccttggc
aggtccttctag

DBGET integrated database retrieval system