KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_124793Help
Entry
BRAFLDRAFT_124793 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BRAFLDRAFT_124793
   00240 Pyrimidine metabolism
    BRAFLDRAFT_124793
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BRAFLDRAFT_124793
   03410 Base excision repair
    BRAFLDRAFT_124793
   03420 Nucleotide excision repair
    BRAFLDRAFT_124793
   03430 Mismatch repair
    BRAFLDRAFT_124793
   03440 Homologous recombination
    BRAFLDRAFT_124793
DNA repair and recombination proteins [BR:bfo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      BRAFLDRAFT_124793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 115 aa AA seqDB search
MSQMRITDTFQKVKRPGRTQKQGKPTQIAGKTSQAPAQSASDAAVLQRQTDIQLLKQFDL
NPGYGPSIGITRLERWDRAEKFGLTPPEDVRDLIVQHTEDEEYTHCLWNDYKQML
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagatgaggatcaccgacacgttccagaaggtaaagaggccagggaggacacag
aagcagggaaaaccgacacagattgcgggtaaaacttcacaggcccctgcccagagcgca
agtgatgcagcagtcctacagagacaaacagacatccagctcctcaaacagttcgacctg
aacccaggctacgggcccagcataggtatcacaagactggagcgatgggatcgtgcagag
aagttcgggctgactccgcccgaggatgtgcgagacttgattgtacagcatacagaggat
gaggaatacacacactgcctgtggaatgactacaagcagatgttgtga

DBGET integrated database retrieval system