KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_124793Help
Entry
BRAFLDRAFT_124793 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bfo00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bfo00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bfo03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bfo03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bfo03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bfo03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bfo03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 115 aa AA seqDB search
MSQMRITDTFQKVKRPGRTQKQGKPTQIAGKTSQAPAQSASDAAVLQRQTDIQLLKQFDL
NPGYGPSIGITRLERWDRAEKFGLTPPEDVRDLIVQHTEDEEYTHCLWNDYKQML
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagatgaggatcaccgacacgttccagaaggtaaagaggccagggaggacacag
aagcagggaaaaccgacacagattgcgggtaaaacttcacaggcccctgcccagagcgca
agtgatgcagcagtcctacagagacaaacagacatccagctcctcaaacagttcgacctg
aacccaggctacgggcccagcataggtatcacaagactggagcgatgggatcgtgcagag
aagttcgggctgactccgcccgaggatgtgcgagacttgattgtacagcatacagaggat
gaggaatacacacactgcctgtggaatgactacaagcagatgttgtga

DBGET integrated database retrieval system