KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_124878Help
Entry
BRAFLDRAFT_124878 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K16172  
insulin receptor substrate 1
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_124878
   04150 mTOR signaling pathway
    BRAFLDRAFT_124878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1203 aa AA seqDB search
MRPGAPCRMSRDLRSYRAQISAGDRVSSPDRSCGVCRGSRHDVCWRGHSRGRAETRIPAE
TQGGSYGPGCESARGEGEGGYGTGRGASLLEGRVRVGTVRAGVRRKGLGQSLPWSEERAK
VSTGQSMRGGSGWVRYGPEYEGWVRVGTSKARVQVHPNGASGSVLARVRLYWTGCKYGQG
VNGRKGVREGPGLVRTRVRLRGEAMVSMAQSLREEPESAREMVTVCMGLGAVGRSGLTMK
KRYFVLHAKSSAGAARLEYFDNEKKWRHGAAPKRTIFLHHCFNINKKDDGKHKHMIVLYT
RDECFSLVADTADEHDTWLAVLKDLHESGSQEGFISKQNFEHVWQVTLKPKGLGSSKNLT
GQYRLCLTANSITLLKMNSEEPAMDFQLTQIRRCGHVESFFLMEVGRSAVTGAGELWMQV
EDTLVAQNMHEAILSSMKAISSDDEFRPRSRSSGSSNPLPVPAGRRMTGTVPTMALSHTL
PTRSRMRCDSLPTAPGRGGARYRTTSEGEMKTNSPVSPSRNRTRLSAIHQRSSPRSVIGS
HGMFNRSVSAAGSLSQSPISGSPLSPSPTGFASDQYAHPLPISRGLMEYTSDGSTVSMDE
YDSSPASSDHYLHKYTSLPTVSTLTTYSKGGCNQGGGCSQGGGYVPMAPAFPGGYPTRSA
PQDVGYPTRSTPQEGSYMPMSGGIGRGSPTTLSSRLEDGYMPMSPGTPPTTTDMRLDESY
MSMSPSSVSAPRQIVTRRPANGDPYVTMSPGSRSPDHAEYMQIWANQRPDNRQNNNNNDD
SSYMSMSPVAQALPNTSNTYIVYSPSAESSPPAAVIEKGQMEATDGYVHMEMQPRRTGTE
TARRTGQTTQDDNYMAMDFGAKGSERLSASERLSSSLPAEHHLSSSPGGTNRPTTLRLTN
QHEYINVTPTAAPNDGYAVMDYISGDGGVASSDESRTSAADGKTSTSESGIYSGEESGRP
RSPGEYVNIDYSTKGADGPGSEGDGSEYMNLTYPSEKPSPKIHVSDYSLMAPVSIAERPE
KGAGKSPGLLKQDSLTSEDEGLSSQGVIRHSPVFSTSADISVVKNSKESPEGGASPVTVE
TAAGASPVTAVTGASPVSGGSYENVSLGSRQGGGLTQSSQPGSRHSSVSSEKELNYISLD
LPSDEGEGAAGDDNPVAKATRSPRSSVSSEDKADENPYASIDFTKSEGLRNTSPKYHDRD
GRF
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctggggcgccgtgtcggatgtcacgtgacctgagatcatatcgcgcccagatt
tcggcaggcgacagagtgagttcccccgaccgttcctgcggagtttgccggggaagccgc
catgatgtctgctggcggggacactcccgaggacgtgcggaaacacggatacctgcggaa
actcaaggtgggtcctacgggccagggtgcgagtctgcccgaggggagggtgagggtggg
tacggtacgggccggggtgcgagtctgctcgaggggagggtcagggtgggtacggtacgg
gccggggtgcgaaggaagggcctgggtcagtccttaccatggtctgaggagagggccaaa
gttagtacaggccagagtatgaggggtgggtcagggtgggtacggtacgggccagagtac
gaggggtgggtcagggtgggtacgtccaaggccagggtgcaagttcatccgaatggagcg
tcggggtcagtactggccagagtccgtctgtactggactgggtgtaagtacggtcagggt
gtgaatgggaggaagggtgtgagggaaggacctgggttggtacgcacaagagtacgacta
cgaggggaggctatggtcagtatggcccaaagtctgagggaagagccagagtctgcccga
gagatggtcactgtctgtatgggcctgggcgcagtaggacggtcagggttgacgatgaag
aagcgttacttcgttcttcacgcgaagagcagcgcgggggccgcccggctggagtatttc
gacaacgagaagaaatggcgtcacggcgcggcgccgaaacgcacgattttcctgcaccac
tgcttcaacatcaacaagaaggacgacgggaagcacaaacacatgatcgtgctgtacacg
cgcgacgagtgcttctcattggtcgctgacactgccgacgaacacgacacgtggctcgcc
gtgctcaaggacctgcacgagtcgggctcgcaggagggcttcatcagtaaacaaaacttt
gaacatgtgtggcaggtgacgctgaagccaaaaggcctgggcagctccaagaacctgact
gggcagtaccgcctctgtctcacagccaacagcatcactctgctcaagatgaactctgag
gaaccggctatggacttccagttaacccagatccggcggtgtggccacgtggaaagtttt
ttcctgatggaagtcggccgctcggcggtgactggcgccggtgaactctggatgcaggtc
gaggacacgctggtcgcacagaacatgcacgaggccatcctcagctcgatgaaagccatc
agttcagacgacgagttccggccgcgcagccgcagctccggttcgtccaacccgctgccg
gttcccgcggggcggcgcatgaccgggaccgtccccaccatggcgctgagccacaccctc
cccacccgcagccgcatgcgctgcgactccctccccaccgccccggggagaggcggcgcc
aggtaccgcaccaccagcgagggcgagatgaagaccaacagtcctgtcagccccagcaga
aatcggacacggttatcagcgatccaccagcggagcagcccgcggtccgtcatcgggtcc
cacggcatgttcaaccgctccgtgtcggccgcgggctccctctcacagtcccccatctca
ggcagcccgctcagccccagcccgacaggcttcgcgtcggaccagtacgcccacccactg
ccgatcagccggggcctgatggagtacaccagcgacgggagtacggtctccatggacgag
tatgactcaagtccagcctccagcgatcactacctacataagtacacctcactacctaca
gtaagtaccctcactacctacagtaaggggggctgtaaccaaggcggggggtgtagccag
gggggtggctacgtgcccatggctcctgcattcccaggtggctaccccacgcggtcggcg
ccccaggacgtgggttacccgacccgctccacaccccaggaggggtcgtacatgccgatg
tcgggcgggatcgggcgcgggagccccacgacgctgagctcgcggctggaggacgggtac
atgccgatgtcgccggggaccccgcccacgacaaccgacatgagactggacgagtcctac
atgagcatgagcccttcgagtgtttcggcgccacgacagatagtcacccgtcgcccagcc
aacggcgacccgtacgtgacgatgtcaccgggaagccggtcacctgaccacgcggagtac
atgcagatctgggccaatcagagaccggataacagacagaacaacaacaacaacgatgac
tcatcctatatgagcatgtctccagtggcacaggcactgccaaacacttcaaacacgtat
atcgtgtactccccgtccgcggaatcgtccccgccggctgccgtaatcgagaagggtcag
atggaggctacggacggctacgttcacatggagatgcagccgcgcagaaccggcacagaa
accgctcgcagaaccggacaaacgacccaggacgacaactacatggccatggacttcggc
gcgaagggctcggagcggctgtcggcgtcggagcggttatcgtcgtctctccccgcagag
caccatctatcgtcatcgccggggggaaccaaccgtccaaccacgctcaggctgaccaat
cagcacgagtacatcaacgtgacgcccaccgccgcacccaacgacggctacgcggtcatg
gactacatatcgggtgacggcggggtcgcgtcctcagacgagtcgcgaacctccgcggct
gacgggaaaacgtcgacatctgagtccgggatctattcgggtgaggaatctggccggccg
cgcagcccgggcgagtacgtcaatatcgattacagtaccaagggcgcggacgggccgggc
tcagaaggggacggctccgagtacatgaacttgacatatccgtcggagaagccctcgcca
aagatccacgtgagcgattactcgctgatggcgccggtgagcatcgcggagcgtccggag
aagggcgcgggaaagtctccggggctgctgaagcaggacagcctgaccagcgaggacgag
gggctgtcgtctcaaggggtaatccgacactccccggtgttcagcacgtccgcggacatc
tccgtggtgaagaactcgaaggagagtccggagggcggcgccagccccgtaaccgtggaa
actgcagccggcgccagcccggtaaccgcggtaaccggcgccagcccggtgtcaggcggt
tcgtacgagaacgtttcgctggggtcgcgtcagggcggcgggctgacccagtcttcccag
ccgggctcgcggcactcgtccgtcagcagcgagaaggaactgaactacatctcgctggac
ctaccctctgacgagggcgagggcgccgccggcgacgacaaccccgtcgccaaggcaacg
cgctctccgcgcagcagcgtgagctcggaggacaaagctgacgagaatccgtacgccagc
atcgactttactaaatccgaggggctgcgcaacacctcgcccaagtaccacgatcgggac
ggcagattctga

DBGET integrated database retrieval system