KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_125045Help
Entry
BRAFLDRAFT_125045 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    BRAFLDRAFT_125045
Enzymes [BR:bfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     BRAFLDRAFT_125045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1490 aa AA seqDB search
MKEDICAQSKTECSFKSTDLLHGPGYMEQRRDDLFHTSAISWCCGYRYSTQTDFQAGFLW
TNYGGTINMCVRHRQGDVNTDLKSCCTSTHLLVTMATDGDAEGIEMSDENFYENLDDIIS
GLVNEKLESSGWVEGLPPGMAAIERDLGSLEDQQARIQDVFRESERLLGVAGENLAWQQT
WFNDWMEHNRTGSPEEMVDLTAEDDEVMVVSEGPATQQQQLQQPQQQAQQRQEQEHQSEL
PSTPQAATEEETVPTAPQPPQTESSVPTTNQESGTSSEQPIADQNEEQVQREVAPGTSDP
VSVELAVGMRLMGKKKDDIWYQGTLIKIVPDEKGLIKYKVKYDGKGKGLLSGNHIAFSET
VGQGVLHAGSRIVGQYVDEEGDSVQYLYAGIVAELPSKMNRSRYLIFFDDGFATYLKRDQ
IHQRAMVKVKVGQKIRTEWNGQWWDARVDSVDGSLVKMYYPTDKRSEWIYRGSTRLWPLY
EAFAHQEQAQTEGSKSIRSHTMGKTRGPHIEYTRAEEEAAKRKTTGAAQKKPASASASSA
SQSKPPSRSSTPRSSSTVDSSSLSFEKLLTEDIEKLQAGSKLVPSTSSELQNSGGGMGRP
VANREAWFQIAGATQKKTVTSQQSNTTVKQTVTSQQSNTVVKHVVPTTVKQTVTTTQPPV
TTTAQRINRPLKKQVARKSTGPRSKKPFPDQYVPPSVGRKDIASILQKRLMEEGDSNSRS
SEDSVVDITVETDPMEVPTPKMVKFSPHQCTPACVSHVRPANPAQYRGRGAWPHINPLKV
PILYQWERYIGKKRPGGTRDVSYRTPCARMVRNVRDVSWYLMQTKTDFLSIDQFCFDPYV
MLDNMRPEKYFVKIPDISNGNEDVPISCVNEINHEHPDNVGYTKQRLPTPGVELNLDPDF
LVSCDCTDNCQNKKTCACHQLTIQAYRSRPGGQEDPDAGYEYRRLTEQLPTGGWGIRCLD
DIPQGAFICIYAGQLLNEDTANKGGNMFGDEYLAELDHIEIAEKFKEGYESDVPDSSGSD
LNDSDSESDNSSSAEEPSITSSTSPEPDLDNSSDSDYKPDITDKPGDTSGAVKLILRRES
RGSTSGRSVKPQKCDTDKKVESWIEKNLSEKKSGDTGSQSESRSSSGRNTPKQTHQSQDS
KPGLPQPNKEDQSQSVDTNPAKKESSVHEQERHNIFDIMEFSESKDGTSKTPDREVQKKG
DTNRSFQDALKDMNVSMELSPKKAPGQQGTVGAKKDSGKDDGMACTIVEEKEAAEGKAER
REGDVQDKTGKTEGEEKDKKGKDGSSPMRHYGYRIDGDRIVGLKRKHRKKIVVKASSSSE
SEESKPKPASGDCELMIVGATSLAVDSGDETSDSEKGSSSDKGKKKKEKDQLEVPAPVLD
DTQQPVAVLQPSPDRSTRKYFGEEHCYVMDAKVIGNCGRYLNHSCSPNLFVQNVFVDTHD
LRFPWVAFFSSKRIRGGTELTWDYNYQVGSVAGKVLYCYCGSEECRGRLL
NT seq 4473 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagatatatgtgcacagtcaaaaacggagtgcagtttcaagagcactgatttg
ctccatggacccggatacatggaacaaagaagagacgacctgttccacacctctgccatc
agctggtgttgtgggtacaggtacagtacacaaacagactttcaggcaggctttttgtgg
acgaactatggcggaaccatcaacatgtgtgtccggcacaggcagggcgatgtcaacaca
gatttaaagtcctgctgtacatccacacacctgttggtcaccatggcaacagatggagat
gcggaggggatagagatgtcagatgagaatttttatgagaacctggatgacatcatctcc
gggctggtgaatgagaagctggagagtagtgggtgggtggagggtctgccacctgggatg
gcagccatagagagggacctgggaagcctggaagatcagcaggcccgtatccaggatgtg
ttcagggagtcagagcgactgctgggcgtggccggggagaacctggcatggcagcagaca
tggttcaacgactggatggaacacaacaggactgggagccctgaagagatggtggatctg
acagctgaggatgatgaggtcatggtggtatcagaggggccagctacacaacaacaacaa
ctacagcaaccacagcaacaagcacaacagagacaagaacaggaacaccagtctgagctg
ccgtccactccacaggcagcgactgaggaggagactgttcctacagcaccccaaccaccc
cagactgagagctcagtaccaacaaccaatcaggagtcaggaacatcctctgaacagcca
atagcagaccagaatgaggagcaggtccagagagaggttgctccaggaacatctgaccct
gtgtctgtggagctggctgtgggcatgagactcatggggaagaaaaaagatgacatctgg
taccagggtaccctcatcaagatcgtccctgatgagaagggactgatcaagtacaaggtg
aagtatgatgggaaagggaagggcctgttgtcaggaaaccacatcgcgttctccgagaca
gtggggcagggagtactccatgctggcagcaggattgtgggtcagtatgtggatgaggag
ggggactctgtccagtacctgtacgctgggatcgtggcggagcttccgtccaagatgaac
cgatcccgttatctcatcttcttcgatgacggcttcgcaacctacctcaaaagggaccaa
atacaccagcgagccatggtaaaggtgaaggtgggacagaagatccgtacggagtggaac
ggccagtggtgggatgcgcgggtagactctgtggacgggagcctggtcaagatgtattac
cccacggacaagcgctcggaatggatctaccgaggttccacaaggctctggccgctgtat
gaagcttttgctcatcaggagcaggctcagactgagggatctaagtccatccgcagccac
accatggggaaaacacgaggcccacatatcgagtacacacgtgctgaggaggaagcagca
aaacgcaagaccacaggtgcagcacagaagaagccagcctctgcatcagcctccagtgcc
agtcagtccaagcccccctcccgcagcagcacaccgcgctcctccagcactgtagactcc
agcagcctttcctttgagaaacttcttacagaagacatcgaaaaactgcaagctggttcc
aaactggtgccatccacaagcagtgagcttcagaacagtggaggggggatggggcggcct
gttgccaacagagaggcctggtttcagatcgctggtgccacgcagaaaaagactgtgact
agccagcagtcaaacactactgtgaaacagacagtgaccagtcagcagtcaaacactgta
gtaaaacatgtggttcccaccacagtgaaacagacagttactaccacccagcccccagtc
acaaccacagctcagagaataaacaggcctctaaagaagcaagtggcaagaaaaagtact
ggcccaaggtcaaaaaagccatttcctgaccagtatgtacccccatctgttggcagaaaa
gacatcgcaagtatcctccagaaaaggttgatggaggagggagattctaacagccgttct
agcgaagacagtgttgtggacatcacagtagagactgaccctatggaggttcccactccc
aagatggtgaagttcagtccacatcaatgcactccggcatgtgtcagtcatgtccgtcct
gccaatcctgcccagtacagaggacggggagcgtggccacacatcaaccccctgaaagtg
cccatcttgtaccaatgggagaggtacattgggaagaagcgccctggtggcactcgagat
gtgtcctaccggaccccgtgtgctcgcatggtgcggaacgtccgggatgtctcctggtat
ctgatgcagaccaagactgacttcctgtccatcgaccagttctgttttgacccttacgtg
atgctggacaacatgaggccagagaaatactttgtcaagattccagacatctccaatggc
aacgaagatgttcccatttcttgtgttaatgaaatcaaccacgaacatcccgacaatgtt
ggttacaccaaacagcgtctccccacaccaggggtggagctgaatctggaccctgacttt
ctggtgtcatgtgactgtaccgacaactgtcagaacaagaagacttgtgcctgtcaccag
ctgaccatccaggcgtaccggtcgcgccccggaggccaggaggaccctgatgcaggctac
gagtaccgcaggctcacggagcagctacctacagggggatggggaatccgatgtttggac
gacatcccccagggagcattcatctgtatctatgcagggcagctgctaaacgaggacaca
gccaacaagggggggaacatgttcggtgatgagtacctggcagagctggatcacattgag
attgctgaaaagtttaaggaaggctacgagagcgatgttccagacagcagtgggagcgac
ttgaatgactccgacagcgaatcagacaacagtagttctgcagaggaaccctccataacc
tcctccacctctcctgagcctgacctggacaacagcagtgactctgactacaaacctgac
atcacagacaagccaggagacaccagcggagctgtcaaactcatcctgcgccgagagtcc
cgggggtcaacatccggcaggtctgtgaagcctcaaaaatgtgacacggacaagaaagtg
gaatcctggatagagaagaacctctctgaaaagaaatcaggagacacaggtagccaatca
gagagtaggtcctcctctggtagaaacactccaaagcagacacaccaatcacaggacagc
aagcctggccttccacagccaaataaggaagaccaaagccaatcagtggatacaaatcca
gccaagaaggaatcatccgtgcatgaacaagaaaggcacaatatttttgatataatggag
ttttctgaatcaaaagatggaaccagcaagactccagaccgtgaagtacaaaagaaagga
gacactaatcgctccttccaagatgccttaaaagatatgaatgtctctatggaattgtca
cccaaaaaagcaccaggacagcagggtacagtgggagcaaagaaagactctggcaaggat
gatgggatggcatgtacaattgttgaagagaaggaggccgctgaggggaaagcagaaaga
agagagggtgatgtacaagacaaaacaggaaaaacagaaggagaagagaaggataagaaa
ggcaaagacggtagttcaccaatgaggcactatgggtaccgaatagatggtgaccgcatt
gtaggactgaagaggaaacacaggaagaagattgttgtaaaggcatcctcctccagtgag
tctgaagagtccaaacctaaaccagccagtggggattgtgagctgatgattgttggcgca
acatcgctcgctgtcgacagtggagatgaaacatccgacagcgagaagggctcatcatca
gacaaggggaagaagaaaaaggagaaagaccaacttgaagtcccagccccggtcctagat
gacacccagcagccagtggcagtactgcagccctcacctgacagaagcaccaggaagtat
tttggagaggaacattgttatgtcatggatgccaaggttataggcaactgcggcaggtac
ctcaaccatagctgctcaccaaacctgttcgtacagaatgtgtttgtggacacacatgac
cttcgctttccctgggtcgcctttttctccagcaagcgcatccggggaggcaccgagctg
acctgggactacaactaccaagtgggtagtgtagcaggcaaggtgctgtactgctactgt
gggtcggaggaatgtcgaggccggctgctgtga

DBGET integrated database retrieval system