KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_125898Help
Entry
BRAFLDRAFT_125898 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BRAFLDRAFT_125898
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRAFLDRAFT_125898
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    BRAFLDRAFT_125898
Enzymes [BR:bfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     BRAFLDRAFT_125898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 424 aa AA seqDB search
MFTATISQMVTEIIGPKEAGLKKPTIPEGKTRHLCDVYNSLSTEDKATFLRVVSQQFGTD
HDEVLKAAEGLPQAKEKSEGALLKAEERLQAALVPRYHDLFVQIGRLEGGVKHLVDMRAD
TLDLLSSVKDSAELRSFSSCLREMLSHWFSAGLLHLQRITWESSCDILQKISEYEAVHPM
RNWSDLKRRVGPYRRCFIFTHSTMPREPMVVLHTALTNQISDNIQTIVSTPILDEEDVDN
INTAIFYSITSTQKGLQGVELGNYLIKRVVRELQAEFPKMTQFSSLSPIPGFRDWLVGEI
NKVLGSTESSSSEDSGVDGPSSTAPTLLTSAELQKVAEIAGKEDVSPLVTLKKLLQTNQW
MGAESMVEVLKDPLMRLCARYFLGDTMRNSQRYMEEQHIEASQQVIDLAQAAGGADSPAG
KSNL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgttcacggcaaccatctcacagatggtcacggagatcatcggacctaaagaagctgga
ctgaaaaagccaacgatacctgaggggaaaaccaggcacttatgcgatgtgtacaactcc
ctgtcaacagaagacaaggcgacgttcctacgggtagtctcacagcagtttggtacagat
cacgatgaagtactgaaggctgcagagggtctaccacaagcaaaggagaaaagtgaaggt
gccttgctgaaggcggaggagagactacaggcagcgctggtacccaggtaccatgacctg
tttgtgcagatcggtcgactggagggcggagtcaaacatctggtggacatgagagcagac
acactggacctcctgtcttcagtaaaagacagtgcagagctgcggagcttcagctcgtgt
ttgagagagatgctgtctcattggttctcagcagggctgctacatcttcagaggataaca
tgggagtcatcatgtgatatcctacagaagattagtgagtacgaggctgtccaccccatg
aggaactggtcggacctgaagcggagggtggggccctacaggaggtgcttcatcttcact
cacagcaccatgcccagggaacctatggtggtcctgcacacagcactcaccaatcagatc
tcagataacatccagaccattgtatcaacccccatcctggatgaggaggatgtggacaac
atcaacactgccatcttttactccatcacctctacacagaaaggtctccagggagttgaa
cttggaaactacctcatcaagcgggttgtacgggaactgcaggcagagtttcctaagatg
acccagttctcgtccctctcccccatccccggcttccgtgattggttggttggagagatc
aacaaggtgctaggctctacagagtcttcctcatcagaagacagtggggttgatggtcct
tcatctacagctccaaccctcctgacttcagctgagcttcagaaggtggcggagattgca
gggaaggaagatgtgtcaccattggtcacactgaagaaacttctacagaccaaccagtgg
atgggagcagagtccatggtggaggtactgaaggatccacttatgagattatgtgcaaga
tatttcctgggggacacgatgaggaacagccagcgctacatggaggaacagcacatcgag
gcctcccagcaggtcatcgacctcgcacaggctgcagggggggcggacagtccagctggg
aagagtaatctgtag

DBGET integrated database retrieval system