KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_126072Help
Entry
BRAFLDRAFT_126072 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 601 aa AA seqDB search
MRWGLVARLCTPPVSERISPREAGQHRLSFGKVSCDNLLSLVVSSRSRLTRGPVCTRPPE
QDLDSVLVVTKKLSNFSRSLDWNRASNYVAKRYIEKVERDVYFEDVKLQMDAKLWGEEFN
RHDPPKKVDIMQVVILEFKDRPGSPLYHLEHFIEGKYIKYNSNSGFVEDEALRCTPQAFS
HFTFERSSHNIIVVDIQGVGDLWTDPQIHTKEGTDYGDGNLGTKGMALYFHSHSCNRICK
ALNLTAFDLSNSEIANLERAQVIQTSSKTILRGSEEIVIDPRLKNTGDITLFLRQRSESP
RNSPRVSESEDVHMMSSSVSPPYSPVNFLDDDPFPPSLRRLRSDSENSSITREAEHEEFA
RRQVSRPSCVNLEVNFRRMSLIQGQLTGGSILGEVHLEMAKYHENGRFAPQQGLNMLHEE
EVDWDSAIFHLEKAAVCGVLEAIVALARMFLQLPHDVLEGAHVENTEENTNRGVDYMRMA
AVAGDRGAMIYLANAYHTGSGLGTERDIDWVEATRWYDQAVNQSGEDEEGCYDATMEEPA
YLLMAKEAELYREGGHGLEKDPERAAELYNDAAEQAMAAMKGRLASKYFMFAEECWGEME
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggggattggtagctaggctctgcacgccgcctgtcagtgaaaggatatcaccc
agggaagcgggccagcatagactaagttttggaaaggtcagctgtgataatctgctgagt
ctggtggtgtccagccggtcaagactgacccgtgggcccgtgtgtaccaggcctcccgag
caggaccttgacagtgtgctggtggtcacgaagaagctgtccaacttctccaggtcctta
gactggaaccgtgcgtcgaactacgtggccaaacggtacattgagaaggtggagagggat
gtgtactttgaggacgttaaactccagatggacgccaagctgtggggagaggagttcaac
cgacatgaccctccgaagaaggtggatattatgcaggttgttattctggagtttaaggac
cgacctggctctcctctgtaccacctggagcacttcatcgaggggaagtacatcaagtac
aactctaactctggctttgtagaggacgaggcactcaggtgcaccccacaggcatttagt
cacttcacgttcgagcgctcgtcccacaacatcatcgtggtagacatccagggggtgggg
gacctgtggaccgacccccagatccacaccaaggaggggacggactatggggacgggaac
ctgggtaccaagggcatggcgctgtacttccactcccactcctgtaacaggatctgtaag
gccctgaacctcaccgccttcgacctgtccaacagtgagatcgctaacctggagagggca
caggttatacagacatcatcaaaaacgatcttgcgtggatcggaggaaatcgtgatcgac
ccaaggctgaagaatacaggcgacatcacactgtttcttcgccagcgctccgagagtcct
cgcaactccccgcgtgtgtcggaatcagaggatgtccacatgatgtcatcctctgtttcc
ccgccgtactcccctgtgaatttcttggatgacgacccgtttccaccgagtctgcgccgc
cttcgatcagactctgaaaacagctctatcactcgggaagcggagcacgaggaatttgcc
cgccgccaagtgagccgaccatcctgcgtgaatctggaggtcaatttccgcaggatgtcc
ttgattcaaggtcagctcactggaggttctatcctgggagaggtgcatctggagatggca
aaataccatgagaacggtaggtttgccccacaacaaggactgaacatgctgcatgaggag
gaggtggactgggactcggccatcttccatctggagaaggctgctgtgtgtggagttctg
gaggccatcgtggctctggccaggatgttcctgcagttgcctcatgatgtgctagagggg
gctcatgttgagaacacagaagaaaacaccaaccgaggtgtagactacatgcggatggca
gcggttgcaggggatcgcggtgccatgatctacttggcaaatgcctaccataccggctcg
ggccttggaactgaaagagatatagactgggtagaagccacccgctggtacgaccaggct
gttaaccagtcaggtgaggatgaggagggttgttatgatgccaccatggaggaaccagcc
tatttactgatggccaaagaagctgagctgtacagggagggtgggcatgggctggagaag
gaccctgaaagagctgcggagctgtacaatgatgctgcagagcaggccatggctgccatg
aagggtcgcctggccagcaagtacttcatgtttgcagaggagtgttggggagagatggag
gaatga

DBGET integrated database retrieval system