KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_126429Help
Entry
BRAFLDRAFT_126429 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Module
MAPK (ERK1/2) signaling
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BRAFLDRAFT_126429
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: Other group
  MOS family
   BRAFLDRAFT_126429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 403 aa AA seqDB search
MAGTRAVRTARKLLLAAAQLVERQRSLLRAALEMGCTPKKPSPSPHQARRFSKKVREWAF
SRNSSDSASKKESGDSGACNNNGAAPERSGPDGKPAALSCCRVVPFKKSRDVARCSVSEE
DLHRGQTIGNGGFGTVYEGRYGGKRVAVKVLDRCRHNLPAAVQSFQAELCVLDLRHPNIV
RTLAVSSSTLRDNTFIVMEHAGEKNLQQVISDPEEPLYIRRRLRFALDISKALDYSHKHN
IAHLDLKPANVMVTHDDRCKLGDFGCCQVVDGETGRVSPTERSHLTGTFAYRAPELMRGD
PPTTRADIYSYGITLWQMRSREHPYLGENPHVVIFGVVANNVRPSFPENDEEEASVLEGW
YQRHASRCWSALPSSRPSATEVVEALEEKLFALRPDRTESISL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaacgcgggcagtgcgcacagcgcggaaacttctactcgccgctgcacagctt
gtggagaggcagcgctcgctgctgcgtgctgcgttagagatgggatgtacgcctaagaaa
cccagcccgagtcctcaccaagccaggaggttcagcaagaaggtgagagagtgggcgttt
tcgaggaattcatccgactctgcgagcaagaaggaatctggagacagcggagcctgcaat
aacaatggggcggcgccagagaggagcgggcccgacggcaagccggcagcgttgtcgtgc
tgtagagtcgtgccgtttaagaagagtagggacgtcgccaggtgtagcgtgagcgaggaa
gacttgcacagaggacagacgataggaaacggagggttcggaacggtgtacgaaggcagg
tacggaggcaagcgggtcgccgtgaaggtgctggaccgatgcagacacaacctgccggcg
gcggtgcagagcttccaggccgagctgtgcgtcttggacctccggcacccgaacatcgtg
cggactctcgccgtgagctcgtccaccttgagggacaacacctttatcgttatggaacat
gcaggtgagaagaacctccaacaggtgatctcagaccccgaggaacctctgtacatcaga
agacgtcttagattcgccttggacatttcaaaagccttggattactctcacaaacacaac
atcgcgcacttggacttgaaaccggccaacgtgatggtcacccacgacgaccgctgcaag
ctgggggacttcgggtgctgccaggttgttgacggggagacggggcgggtcagcccgacg
gagcggtcgcacctcaccggcaccttcgcgtaccgcgcgcccgagctcatgcggggggac
ccaccgaccacccgcgccgacatctactcctatgggatcacgttatggcagatgcggtcc
cgagaacatccctacctaggagaaaatcctcacgtcgtcatcttcggggtcgttgcgaac
aatgttagaccctcctttccggaaaacgacgaggaagaggcgtctgttctcgaaggctgg
tatcagcggcacgcgtctcggtgctggagcgcactgccgagcagcagaccatccgcgaca
gaagtcgtggaagcactcgaagagaaactctttgcactgagacctgacagaactgagagc
atctcgctctaa

DBGET integrated database retrieval system