KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_126580Help
Entry
BRAFLDRAFT_126580 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:bfo04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:bfo04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:bfo04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:bfo04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bfo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 3563 aa AA seqDB search
MADQLVDGPPTKRQKTSSPTITPTDNNSEFFGKLLDQLGGELPDELDTTSGTDGLANING
TAGNDAGPHQQPPPPQQAAQPANQSNDSTVQRHQQLSQLLQGNTPGSLSTQNVTNSSGPN
STASPQQNHQTSNQTPQTQGQPCASSPNVANANTMRSPLSNNLQSPPSSVGSNASGTPSS
MSFTMSSDSSISTTSIANSIASNTPNLNSINPSQMMNSVSLGMVSSGQHNQIMNGPLMAT
SQNAMGPGMNRNVVSSAGIGNMLNSMSPGHSPQMTPNMGTHPAVVNSGGQMKNTMASTSD
GSVAADLGGMLASGVRLKTVDEFTNEFVIHLRKLQGNASMCLATDLKQLAPLEMMKDIEK
CKEDSLRKRMDSVYLNYKKLSASKNKEKLAIYCKTQFELPKSRESPTAAAAESTSTQYKL
KQTRKELKDSKKRCAQSEHEVYELEQSKEVLTQEYFSVVSQLHENADSFRKIIEEKSDKV
SDLSKALSAANKTNDELTAKLDSLEARLSRVGTVKNVNKKVKRRDETIQKKNELIEQLQG
AVSAGNQELNELREAQEHQTSATEKVRALQTKVKSLQDSKRKLQVKLQKIEEDKVQVQTD
LDATVDTLNGKIQDLENENKHLEAVQSLMDSDTVTTFHEGRYSNDLREVIMNLLTSGVSL
KKVDHVITTVLSKLAGKKIDRFPSVGLKHRLVIEAKILGDRQVAEAIIAGAGNAEQGNCL
HQDGTSKFFKKYQTFDVTTPTGDTLTMSMTEVPSGDAAGILTAFSESCRSLAEVLCEPGE
DVAKKTAEIITSFTSTMSDRGATNPLFNKHLESLRRELLPVVKDEWDTLSDEVKDELGDM
CNYFCKMHLLVNFATEANVTVKIFEDAVSEGKNPFAFAQQGESGAARLIRTACSAFTDRG
NEKSGAPQFFQSYLSQHGEQKNYMVTYRGNRFNILFYNAAAVYHHLKQMVTFVSSWPDAN
NLLKAVKADASQKVYVAGVRALGIIDKTITGPFFRVLGTEKNILGMNTHLHQMQIGLERW
SRDASTLLAGEPLFNETEVERHKDALFDSLFAATEDEDLDVLTQQALEVVCSALLILLER
QAEEQLPGGKFWKPTETEVTKSQHVPTTNVASERDFAILDNLLRAKPYGTSLSFEAHLLW
INNQTSAWLRNLTPEERNKHMDYARTNASRVQQRFKERQSEIKEKRLQTLLERQRQKEEK
RRKARLKTVALTDKVMNMGGVWKTPEEVEDKVKTLNKEQEKLEAIKFQLQFHKQVLKSEG
SKELFQMTITKPGKKKHTFSSEEKILHLKEVVMKNVSGVTDIDLDSEDEDDQEYVTLKEP
EARTVPEMRVKLVEKRDIAREKREIDRQKQSLPVYIKDPSKLVGCRVKHQCDSTDEQGNK
EARWFEGAVTEIVNRTEEAKDTVYKIVYDDENENGAAEKGCHLRLKVTTTARRKSSLLVN
VLLGSTLAVVTSTPTTPSHPPPPKHPYHPASTVLVPRLDQNYLGQQPTTSSSPYNHPFPS
PMSVGSSVPASSPPSLSLSNSMSMSASFSQIPSTAPVAGPNVMSSVGNGNMAPAQVPPQG
VTAPTADPEKRKLIQQQLVLLLHAHKCQRREQSAVNGEVRTCQLPHCRTMKNVLTHMTHC
QAGKNCQVAHCASSRQIISHWKNCTRSDCPVCLPLKNVSSRKEVQASMGLTAQLPQLTHT
QTSSATGLPGVPQQPQPPPQPAGPQPQPQPQQQQIDHTSMQRAYAALGLPYNQNNPPNRA
RSMQLGQQQGLGPGGPGNLNGGPSLGAELSAMQRQQTSLFHSLDSSGNVTIQQQPPKRVQ
PWHQHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMGNLVAYARKVEGDMYETANSREEY
YHLLAEKIYKIQKELEEKRHRRLQEQQLRGTGPAQAAAAMVPGAAPGIQAAPRPQVDLAT
GIAANLAAIGPNQQTQGTPQPFLPNTPQQGQQSGFPSGNVSLNTSMSSLLPNVQNMTAQQ
QQQQATSLGQVLAAVRDISKKLLPASGPSPQPINRPTPVQQPTPTQPQMEQSNKMGQQGP
QPTAPMQQQQQQQQQQQQQGIQPGQQTTPHQTPPRPGSATPTSQPQPVQTVAPPAPLDEN
QQAPPNVVAPPGTTIPTTLASSTVTSAATTTTMTTTSQVGDGVQPMETSQSAVTVKQEAA
PRVLAQQQPSEQQQADIKTEVKTEQVMGTASCKDGSGAGVKTEAKSPGGMSIKQDTQSPS
PAAVQQDSGDGPPKPPLIRRPNPNKDFPNKKVFKPDELRQALMPTLEKLYRQDPESLPFR
QPVDPKLLGIPDYFDIVKHPMDLSTIKRKLDTGQYKDPWEYCDDVWLMFDNAWLYNRKTS
RVYKYCSKLAEVFEQEIDPVMANLGFCCGRKYVFQPQALYCYGKSVCTIPWGARYWTYEN
RYHYCQKCFGEIGGDTVTLGDDPSQAQSTIPKSSFEEKKNDVLDLEPYQCDACLKQTGKK
RKENKYTSKRLQTTKLGTFLENRVNTYLRERCVEAGEVTIRVVHVSDKMVEVKPGMKNKF
VDSGDMPEQFPYKAKALFAFEEIDGVEVCFFGMHVQEYGSDCPQPNHRRVYISYLDSVHF
FKPRNLRTAVYHEILIGYLDYVKKLGYTMGHIWACPPSEGDDYIFHCHPPEQKIPKPKRL
QEWYKKMLDKAVAEGVVKDYKDILKQATEDGVSMANELPYFEGDFWPNVLEESIKEIDQE
EEEERRAQEAAAAIAQESNGDQFIGFGALQGNGDKKKGKKNKGSKSKSKSSSNRKNNKKS
NFPNQGNNLSQKLFQTMEKHKEVFFVIRLIASNIASNLPSISDPDGLIQCDLMDGRDAFL
TLAREKHYEFSSLRRAKFSAMAMLYELHNQGQDRFVYTCNHCKQHVETRYHCTVCEDYDL
CIACYEKQGHQHKMEKWGLGLDDGDTSQSNQSPQEARRLSIQRCIQSLVHACQCRDANCR
LPSCQKMKRVVQHTKSCKRKTNGGCPICKQLIALCCYHAKHCQEQKCPVPFCLNIKHKLR
QQQLQQRLQQAQMLRRRMATMQSRGMTPSQPSLPPPSAPASMPTQQTLQTRPPSQGKPGK
PTHPGKPGSMAPPPAAPPAAIQAAEEAKRAAALAAAQQGGFGRGMPNQGQQMPPPQLNMP
NLQQQMQQQQQQQQQQQQQQRPLAQQQMVQQSMPNQSPMQRWPGVFQQQSQAGMQPQQQQ
QGMQGMMQGQQVNPAALQVQQGIRNQFPAQALQQLVQTLKSPSSPQQQQQVLSILKSNPQ
LMAAFIKQRTQHQQMQQQMQQQQQQQQPGQPIQQQPMTPQQQQQWQQMRMRQMAQQMQSQ
QQQQQQQQQQAQQQQQQQFQQMVPPFSQQSAQHRMMAAQQQQNMPMAPQQGMNQMGQMNQ
MGQMNPMNQMGHVNQMANMNQMGGMNQMGMGGADGGPHSQMQQMMRQHQFQQGAMMQQLP
QQQVQQLKQQMASSMGPGQSMSPQQAMLPPQSPHAAQQMRSPQGGNPIASQVKSPQPTPS
PRPQSHPAPSTPQMSPMHPQNSPHPGVAGPHQPDQMQTEQPMLPQMQPTSQNMGQLEGQQ
NTEESDMAPLTPQDQLTRFVETL
NT seq 10692 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaacttgtggacgggccgccgaccaagcggcagaaaacgtcctcaccaacg
atcacgcctaccgataataattcagaatttttcggaaaattattggaccagctaggtggg
gagcttccagatgaactggacacgacgtcaggaaccgacgggcttgccaatatcaacggg
actgcgggaaacgatgcgggaccgcaccaacagccgccgccgccccaacaagcggcacag
cccgccaaccagtctaatgactctacggtacagaggcatcagcagctctcccagctttta
cagggaaacactcctggcagcttgtccacgcaaaatgtaacgaactcctctggtccaaat
tctactgcaagtccgcagcaaaatcaccagacttcaaaccaaacaccacagactcagggc
cagccctgtgctagtagcccaaacgttgcaaacgccaatactatgcgaagccccttgtcc
aataatttacaatcaccaccaagttctgtggggtccaatgcatcagggacgccttcttcc
atgtcattcacaatgagcagtgactcctcaattagtaccacaagtatagcaaatagtata
gcttcgaatactccaaacctgaactcaataaacccctcccaaatgatgaactctgttagt
ttagggatggtctcgtcaggacagcacaatcagataatgaacggtcctctcatggccacc
agtcaaaatgccatgggacctggcatgaacagaaatgtggtcagttctgctggaatagga
aatatgctcaattccatgtcccctggacactcaccgcagatgacccccaacatgggaaca
cacccagccgtggtcaactcaggtggacaaatgaagaacaccatggcatctacatctgac
ggttccgttgctgctgaccttggagggatgttggcttcaggtgtcagattgaagacagtt
gatgagttcacaaatgagtttgtaatccacttacgcaagctgcaaggcaacgcgtctatg
tgtttagctactgacttaaagcagctcgctccgttggaaatgatgaaggacattgagaag
tgcaaggaggactcactccgaaaacgtatggactcagtttatttaaactacaagaagctc
tccgcaagcaagaacaaggaaaaattggccatctactgcaaaacacagttcgaactgcca
aagtcaagggagtctcccacggctgcagcggcagagtcaacgtcaacacagtacaaactc
aagcaaaccagaaaagagctcaaggacagcaagaagcgatgtgcccagtccgaacacgag
gtgtatgaactggagcaaagtaaagaagtgctaacgcaggagtatttctccgttgtatca
caactgcatgaaaatgctgacagtttcagaaagattattgaggagaagtcagataaagta
tctgacttaagcaaagctctgtctgctgctaacaaaacaaatgacgaactaacagcaaag
ctggactcacttgaggcccgactgtcgagggtgggaactgtaaaaaatgtcaacaaaaaa
gtgaaaaggagagatgagaccatccaaaagaagaatgagttgattgaacaactacaaggt
gcggtcagtgctggcaaccaagaacttaacgagttgagggaagcacaagagcaccagaca
agtgctactgagaaagtgagagcactacagacgaaagtaaagtctttgcaagactctaaa
cgcaaactacaagtgaaactgcagaaaatagaggaggacaaagtccaagtacaaacagac
cttgatgccaccgtggacactctgaatggcaagattcaggatctcgagaatgaaaacaaa
catctagaggcagttcaaagtttgatggacagcgacactgtaactacgttccatgagggc
agatattctaatgatctcagagaagtcatcatgaacctcttgacttcgggagtatctctc
aagaaggtggaccatgttattactacagttttaagcaaactagctgggaaaaaaatcgat
cgttttcccagcgttggcctcaagcacagactggttatcgaggcaaagattctgggcgat
cggcaggttgcagaagcgattattgcaggagctggcaacgcagaacagggcaactgtctt
caccaggatggcacatcaaagttttttaagaaatatcaaacatttgatgtgaccacacca
actggcgacacattaactatgtcaatgacagaagttcccagtggggatgcggctgggatt
ctcacagcattctcagagtcctgtcggagtctagcagaggtgctatgcgaacctggagaa
gatgttgcaaaaaaaactgctgagataataacatcctttacctccacaatgtcggatcga
ggtgcaacaaatcctctgttcaataaacaccttgagagtttacgccgagaacttttgcca
gttgtgaaagatgagtgggacacactatctgatgaagtgaaagatgaacttggcgatatg
tgtaactacttttgcaagatgcacctattggtaaactttgctacagaagccaacgttaca
gtgaagatctttgaggatgcagtttcggaaggcaagaatccatttgcctttgcacaacag
ggtgagtcgggggctgcgagacttatccggacagcttgcagcgctttcacggaccgtggc
aacgaaaagtctggagcgccgcagttcttccaaagctacctgtcccaacatggagaacag
aagaactacatggtgacgtatcgcgggaacaggtttaacattctcttttacaatgctgca
gctgtctaccatcacctcaaacagatggtcacctttgtgtcatcatggcctgacgcaaat
aatctgctgaaagcggtcaaggctgatgcttcacagaaagtgtatgttgctggggtgcgt
gccttgggcataattgataagactattactggacccttcttccgggtactaggtacagag
aagaacatccttggcatgaacactcatttgcaccaaatgcagataggcctggagcgatgg
tcacgtgatgcaagcacactgcttgcaggggagccacttttcaatgagactgaagttgaa
aggcataaggatgccttgtttgactccttgtttgcagccacagaagatgaggatttggat
gtgctgacgcagcaggctttggaagtggtgtgctctgcattgctgattttgttggaaaga
caggcagaagaacagctcccaggtggaaagttctggaaaccaactgaaacagaggtgaca
aagtctcagcatgtgccgacaacaaatgtagcatcggaacgagactttgccatcttggac
aacttgctgagggccaagccatatggcacgtcactatcatttgaggcgcatctgttatgg
atcaacaatcagaccagtgcctggctgcggaacctgacgccagaagaaaggaacaaacac
atggattatgctcgaacaaatgcaagcagggtccagcaaagattcaaagaaagacagagt
gaaatcaaagaaaaacgccttcaaacactcctggaaaggcagcgacaaaaggaagagaag
aggagaaaagctcgactgaagacagtggccttgaccgacaaagtaatgaacatgggagga
gtgtggaagacacctgaagaagtagaggacaaggtcaaaacacttaacaaagaacaagag
aaactagaagcaatcaagtttcagcttcagttccacaaacaagtcttaaagtcagaggga
agtaaggaactctttcagatgacaatcacaaaaccaggaaagaagaaacacaccttcagc
agtgaagaaaagatcctccacctgaaagaagtggtgatgaagaatgtgtcgggagtaaca
gatattgaccttgattctgaagatgaggatgatcaagagtacgtgaccttgaaggaacca
gaggccagaactgtgccagaaatgcgggtaaagttagttgagaagcgtgacattgcacga
gagaaaagggaaatagataggcaaaagcaatccttgccggtgtacataaaagacccttcc
aaactggttggctgtcgtgtaaaacatcagtgtgactctacagatgagcaggggaacaag
gaagcgaggtggtttgaaggagccgtcacggaaattgtcaacagaactgaagaagcaaag
gacactgtgtacaaaatagtgtatgacgatgaaaatgaaaatggagcggcagagaagggt
tgccacctccgccttaaagtaacaacgacagcaaggaggaagtcatctcttttggtcaat
gtcctcctaggttctacccttgctgtggtgacctccaccccaactaccccatcccacccc
cctccccccaaacatccttaccacccagcctccactgtactggtcccaaggttggaccag
aactacctgggacagcagccaaccaccagcagtagtccatacaaccatcccttcccatcc
cctatgtctgttgggtcttccgtccctgcctcctcccccccttccctgtccctgtccaac
tccatgtctatgtcagcttctttcagtcaaattccctctactgcgcctgtggcaggccct
aatgtgatgtcctcggtgggcaacggcaacatggcccctgcccaagtgccaccacaaggt
gtgacagcaccaacagcagacccagagaaacgcaagctcattcagcaacaactggttctc
cttttgcacgcgcacaagtgccagcgacgggaacagtcggctgtgaatggcgaagtgcgg
acctgccaacttccccactgtcggaccatgaagaatgtcctgactcacatgactcactgc
caggcagggaagaactgccaagtggcacattgcgcatcatccagacaaatcatctcccat
tggaagaattgtacaagaagcgactgtcctgtttgtctaccactcaaaaatgtatccagt
agaaaggaggtgcaggccagcatggggctgactgcacagctcccccagctgacccacaca
cagacgtcgtcagcgaccggcctgcccggcgtgccgcagcaaccccagcctccgccgcag
ccggccgggccccagccgcagccacagccgcagcagcaacagatcgaccacacttccatg
cagcgtgcctatgctgctctaggactgccatataatcagaacaatccacccaacagagcc
agaagtatgcagctgggccagcagcagggtctggggccaggtggaccagggaacctgaac
ggtgggccatcactgggagcggagctgagtgccatgcagaggcagcagacctcccttttt
cacagtctggactcctctggcaatgtgaccatccagcagcagccgcctaagagagtccag
ccatggcaccaacatgtcacacaggacctgagaaaccaccttgtgcataagttagtccag
gctatcttccctacccctgaccccgctgcgctcaaggacaggcggatgggcaatctcgtc
gcgtacgcaagaaaagtggagggcgacatgtatgaaacggccaacagccgggaggaatat
tatcatctactagcagagaagatctacaagattcagaaggagttggaagagaagcgacat
cggcggctgcaggaacaacagctccggggcacaggtccggcacaggctgctgctgccatg
gtgccaggagctgctccaggcattcaagctgcacccaggcctcaagttgacttagcaaca
gggattgctgccaatctggctgcaatagggcccaatcagcagacccaaggaacaccacag
ccgttcctacccaacacaccgcagcagggccaacagtccggcttccccagcgggaatgtg
tcgctcaacaccagcatgagcagcctgctgcccaacgtccagaacatgacggcacaacaa
caacaacaacaagccacgtctctgggacaggtactggctgctgtacgtgacatctccaag
aagttactgccagcatcaggccctagtccacagcccatcaacaggccaacacctgtccag
cagccaacacccacacagccacagatggagcagtccaacaagatgggccagcaaggacca
cagccaactgctccaatgcagcagcagcagcaacaacaacaacaacaacagcagcaaggg
atacagccaggtcagcagacaactcctcatcagactccgcctcgtcctgggtcagccaca
cccacctctcagccccaaccagtgcagactgtcgctccacctgcacctctggacgaaaac
cagcaggccccacctaacgtggtggctccgcccggcaccacaattccaaccactttggcg
agcagtaccgtgacatcggcggccaccaccacgaccatgacaaccacgtcacaggtagga
gatggggtccagccgatggagacctcccagtcagccgtcactgttaaacaggaggctgca
ccgcgagtacttgctcagcaacaaccgtcagaacaacagcaggctgacataaagacagaa
gtgaagacagagcaggtgatggggactgcctcctgtaaggatggttcaggtgcaggagtg
aagacagaggctaaatctcctggcggcatgtcgataaaacaggacacacagtcgcccagt
ccagctgcagtccagcaggactctggagatggcccacccaaacctcctctcatcagaaga
cccaaccctaataaagactttccaaacaagaaagtgtttaagccagatgagctgcgccag
gccctgatgcccaccctggagaagctgtaccgacaggacccggagtcccttcccttcagg
cagcctgtggatcccaagctgctgggcatccctgactactttgacattgtgaaacaccct
atggacctttctaccatcaagagaaaactggacacagggcagtacaaggacccctgggaa
tactgtgatgatgtatggctgatgtttgacaatgcctggctgtacaaccgcaaaacttcc
agggtttacaagtactgctctaagcttgctgaggtttttgagcaggagattgaccctgtg
atggccaaccttggcttctgttgtggaaggaagtatgtgttccaaccacaagctctctat
tgctatggcaaatcggtgtgtactattccatggggagccaggtactggacatatgagaac
cggtaccactactgtcagaaatgttttggtgagatcggcggagacactgtcacactgggg
gatgacccaagccaggctcagagcacaatacccaagagctcctttgaagaaaagaagaat
gatgtcctggatcttgaaccgtaccagtgtgatgcttgcttgaagcagacggggaagaag
agaaaagaaaacaagtacacatcaaagaggttacagaccacgaagctggggacttttcta
gagaacagagtcaacacctacttacgagaacgctgtgtagaagcaggggaggttacgatt
cgagttgtgcatgtgtctgacaagatggtggaagtcaagccggggatgaaaaacaagttt
gtggacagtggggacatgcctgaacagtttccctacaaagccaaggctctgtttgctttc
gaggagattgatggggtggaagtatgcttctttgggatgcatgtacaggagtacggctct
gactgtccccaacccaaccacaggagagtctacatttcctacttggacagtgtgcacttc
ttcaaacctcgtaacctgaggacagcagtgtatcatgagatccttataggctatttggac
tacgtcaagaaattaggatataccatgggccacatctgggcctgccctcccagcgaaggt
gatgactatatattccactgccatccacctgaacagaagatccccaaacccaaacgactc
caagagtggtacaagaaaatgttggacaaggctgttgctgagggtgtggtcaaagattac
aaggacatcctgaaacaagcaacagaagatggggtgagcatggctaatgagctgccatac
tttgagggggatttctggcccaatgtcctggaggagagcatcaaggagattgaccaggaa
gaagaagaggaaagacgagcccaggaagccgctgctgctattgcacaggagtccaatgga
gaccagttcattggcttcggtgctctgcaaggcaatggagacaaaaagaaggggaagaag
aacaaaggaagcaagagcaaaagtaagagcagctccaaccggaagaacaacaagaagtcg
aactttcccaaccagggaaacaacctgtctcaaaagctcttccaaaccatggagaagcac
aaggaggtcttctttgtgattagactcatcgcatccaacattgcgtccaacttgccttcg
atatcggatccagacggactcattcagtgtgatctaatggatggacgtgatgcttttctg
accctggcacgcgagaagcactatgaattctcttctctgcggcgggccaagttctctgcc
atggccatgttgtacgagctgcacaaccagggccaagaccggtttgtctacacctgtaac
cactgcaaacaacacgtggaaaccagataccactgcaccgtctgtgaggattatgatttg
tgcattgcgtgttacgaaaagcaaggtcaccagcacaagatggagaagtggggcctgggg
ctggatgatggagatacatcccagtccaatcagagtccacaggaagctcggcgattgtcc
atccagcggtgcattcagtcgttggtccacgcctgtcagtgccgtgatgccaactgtcgt
ctgcccagctgtcagaaaatgaaacgtgttgtgcaacacaccaagagttgcaagagaaag
accaacggcggttgccccatctgcaagcagttgattgctctttgttgttaccatgccaaa
cactgccaagagcagaagtgtcctgtgccattctgtctcaacatcaagcacaagttgcgg
cagcagcagcttcagcaaaggttacagcaggcacagatgctgagacgacgaatggcaacc
atgcagagtagaggaatgacacccagtcagccatcactgcctcccccaagtgcacctgca
tctatgccgactcagcaaacactacagacacgcccaccatcccaagggaaacctggcaag
cccacccatccagggaagcctggcagtatggcccctccccctgcagcccctcctgcagcc
attcaagctgcggaggaagccaagagagccgcagcactggctgcagcacagcaaggtggc
tttgggcgaggcatgcctaaccagggacagcaaatgcctcccccacaactcaacatgcca
aaccttcagcagcaaatgcaacaacagcagcagcaacaacaacagcagcagcagcagcag
aggccattggcacagcagcaaatggtgcagcagtctatgcctaaccagtctcccatgcaa
agatggcccggtgtattccagcagcagagtcaggcgggcatgcagccgcagcaacagcag
caaggtatgcaggggatgatgcagggtcaacaagtcaaccctgcagcattacaagtacaa
caaggcattcgcaaccagttccctgcccaggccctgcaacagctggtccaaactctgaag
tctcctagctcaccacagcagcagcagcaagtgctaagtatcctcaagtccaacccacaa
ctgatggcagccttcatcaagcagagaacacagcaccaacagatgcaacagcagatgcag
cagcagcagcaacagcagcagccaggacagcctatccagcaacaacccatgaccccccag
cagcagcagcagtggcaacagatgcgtatgagacagatggcacagcagatgcagagccag
caacagcagcagcagcaacaacaacagcaggcccagcaacagcagcagcaacagtttcag
cagatggtaccacccttctcacagcagtctgcacagcataggatgatggctgcccagcag
cagcagaacatgcccatggcaccgcaacaaggcatgaaccaaatgggccaaatgaaccag
atgggccagatgaatcccatgaaccagatgggccatgtgaaccagatggcaaacatgaac
cagatgggagggatgaaccagatggggatgggaggtgctgatggtgggccacactcccag
atgcagcagatgatgcggcagcaccagttccagcagggggccatgatgcagcagctgccg
cagcagcaggtgcaacagctgaagcaacagatggcctcctccatgggccctggccagtct
atgagcccacaacaagccatgctcccaccacagtccccacacgcggcccagcagatgaga
tcgccacagggcggcaaccctatagcaagccaggtgaagtcccctcagcccaccccgtct
ccgcgcccccagtcccatcccgcgccttccacgcctcagatgtctcccatgcaccctcag
aactcgcctcatcccggggtggctgggccacaccaacccgatcaaatgcaaacagaacaa
cccatgctaccacagatgcagccgacctctcaaaacatggggcaactggaagggcaacaa
aacactgaggagtcggacatggcacctttgacaccacaagatcagttaacaagatttgtg
gagacattatag

DBGET integrated database retrieval system