KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_126916Help
Entry
BRAFLDRAFT_126916 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bfo04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 595 aa AA seqDB search
MRSYNCTPLSSPRLPPTYQHPMWQAWDLAVDHCLSQLPAIVDDGAAYRHSPFFADQLTAF
QVWLTMGTERRDPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLAEHRTMAAFV
LAVIVNDYTNGQALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSIAILVYLSRNT
DSPDGAQLQLPHEIARPLAIRAGEQPPPSRPPNPAPIGSAIPHSSTFQSKRRLFDKGPNS
TYDDDDDVSSPPSALITTEFCEWSSRYFAQSVMKFPEEHDPQSPVHYDREWRFIRNARVR
REAREMQKRAVSMRLDDQIFINRNKANPTVVKFHPYDPHMAVADKDGISIWNWDQGARTN
YFRNNNAINSRITALDFINAHDITLLLSGSDDGAVRIWREYGWDGECEPELVTAWQAISD
LLPSTRGSGLVVDWEQESGMLLASGDVRIIRVWDTQKEKKLQDIPTGADSCVTSLVSDSV
GRSLLIAGCGDGSVRLFDRRLAPNECRVMTLREHTGWVVKVFLQKGSEGNIISASVGGDL
KFWDPRFSESVKTIQTSQGLASFDVHPQAEIFACGSANQFISLYTFVYGERKQKQ
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcctacaactgtactccactgtccagtcccagactccctccaacctaccagcac
cccatgtggcaagcctgggacctggctgttgaccactgtctctctcagctacctgccatt
gtggatgatggagcagcttacagacacagccctttctttgcggaccagctgacagcattt
caggtctggctaaccatgggtactgaaagaagagaccctcctgagcagttacctatagtt
ttgcaggttttactgagccaggtacacagattacgagccctcgacctgcttggacgcttc
ctggatctggggccatgggcagtcagcctggcagagcacagaacaatggctgcatttgta
cttgcagttattgtaaatgactacaccaatggacaggccttgtctgttggaatcttccca
tatgtgttgaagttgttacagagctcagctcgggaactgagaccgctgttagttttcatc
tgggcgaaaatcctggctgtggatagtattgccatccttgtatatttgagcagaaacaca
gactccccagatggtgcccagttgcagcttccccatgagattgccagacctttggccatc
agagctggcgagcaaccaccgccctcccgccctcccaaccctgcacccatcggttcagct
attccacattcaagcaccttccagagtaagagaaggctgtttgacaagggacctaattcg
acatatgatgatgatgacgatgtatcctcccctccaagtgcattgatcacgacagagttc
tgtgaatggagcagtcggtattttgcacaatcagtaatgaagtttccagaagaacatgac
ccccagagccctgttcattatgaccgtgagtggaggtttatacgtaatgcccgagtccga
agggaggccagagagatgcagaaaagagcagtttcaatgcgattagatgatcagattttc
atcaaccgaaacaaggcaaatcccacggtggtgaagttccatccatatgaccctcatatg
gccgtggcagacaaagatggaatcagcatttggaactgggatcagggtgccaggacaaac
tacttcagaaataacaatgccatcaacagcaggatcacagccctggacttcatcaatgca
catgacatcacactgctactgtcagggtccgatgatggtgctgtacggatctggcgggag
tatggttgggacggggagtgtgaaccagagcttgtgacagcctggcaggctatatctgat
cttctcccttccacaagagggtcggggttggtggtggattgggagcaggagtctggaatg
ttgctggcgtctggagatgtccgcatcatcagggtctgggacacgcagaaggagaaaaaa
ctacaggacatcccgaccggtgcggacagctgtgtgaccagcctggtcagtgattccgtg
gggcggtcactgctgatagccggatgtggggacggctcagtccgactctttgacaggaga
cttgcacctaatgaatgccgagtgatgaccttgagagaacacacaggctgggtggtgaag
gtgttcctgcagaagggcagtgagggcaacatcatcagtgccagtgtcggaggtgatctg
aagttctgggatcccaggttcagtgagtctgtgaagacgatacagacgtcccagggactg
gcatcatttgatgttcatcctcaagctgaaatatttgcatgtggctctgctaaccagttc
atcagcctctacacctttgtttatggggaacggaaacagaaacagtga

DBGET integrated database retrieval system