KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_127880Help
Entry
BRAFLDRAFT_127880 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_127880
Enzymes [BR:bfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BRAFLDRAFT_127880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 205 aa AA seqDB search
MGILLLREPREEKGTDPYEQEFVAAGLQVKSVEVLSFEFCSLPELRSLVKKPEEFSGMVF
TSQRSVEAVTRCLQEARSLGLTPSGEECGTATQLADLITQKFTSNSKALLFPCGFMRRET
LPSALSAANIPLTELRVYQTTAHPDIDKRLQAYIAEQIAAIGPTTAEAMTSAGLSVACTA
EKPNPQALLAAIQATIAAQATEDPT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggggatccttctgcttagagaacctcgtgaggagaagggaacggacccatatgaacag
gaatttgtagcagctggtctgcaggtgaaatctgtagaagtgttgagttttgagttttgc
agtcttcctgagctcagaagtcttgtcaagaagcctgaggaattctcagggatggtcttc
accagtcagaggtcagtggaagctgtgacgagatgtctgcaggaagccaggagcctcggc
cttactccaagcggtgaagaatgcgggacggctactcaactggccgacctcatcactcaa
aagtttacatcgaatagcaaggcactgctgtttccctgtgggttcatgagaagagagact
ttgccatcggctctttctgctgcaaacataccattgacagagctgagagtctaccagact
actgcacatcctgacattgacaagaggcttcaagcgtatatagctgagcagattgctgcc
atcggccctaccacagcggaggcgatgacctcagctggcctgtccgtagcctgtacagca
gagaaacccaacccacaggccttgctggctgcgatccaggctaccatagctgcacaggcc
accgaagatcccacatga

DBGET integrated database retrieval system