KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_128749Help
Entry
BRAFLDRAFT_128749 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bfo01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:bfo00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bfo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 298 aa AA seqDB search
MASYMLVSFVVCGLFAPSALTSPTPLVIWHGMGDSCCNPLSMGSIKSMVEEQVKGIYVRS
LEIGSNIIEDTENGFLMNVNKQVTMVCDKLAKDTKLANGYNAIGFSQGGQFLRAVAQRCP
NPPMLNLISVGGQHQGVYGFPHCPGDNSTLCDYVRKLLNLGAYNSYVQSFLVQAEYWHDP
LNEEEYKKASIFLADINQENVVNQTYKTNLMKLKKFVMVMFTEDTMVEPRESEWFGFYKP
GSGTELQDLRNTTLYTEDRLGLKEMDSQGKLVFLTSDTDHLQFSKEWFTKNLIPYIKE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatacatgttggtgagttttgtcgtctgcggcttgttcgctccttctgccctg
acgtctcctactccgcttgtcatatggcacgggatgggtgacagctgctgtaacccactc
agtatgggcagtatcaagtccatggtggaggaacaggtcaagggcatatacgtcaggtca
ctggagatcggcagtaatatcatagaggacacagagaatggcttcctgatgaatgtgaac
aagcaggtgaccatggtgtgtgacaagctggccaaggacaccaaactggccaatggctac
aatgctattggcttttcacaggggggacaatttctgcgtgctgtagcccaaagatgcccc
aacccacccatgttgaacttgatctcagtaggcgggcagcatcaaggtgtgtatggtttc
ccccattgccctggagacaactccaccctctgtgactacgtgaggaaactgctgaacctc
ggagcctacaacagctacgtgcagagctttttggtacaagctgaatactggcatgaccca
cttaatgaggaagagtacaaaaaagctagtattttcctggctgacatcaaccaagaaaat
gtggtgaaccagacctacaagactaacctgatgaagctgaagaagtttgtgatggtcatg
ttcacagaagacaccatggtcgagccaagggagagcgagtggtttggattttacaagcca
ggctcggggactgaactgcaggaccttcgcaacacaacattgtatacagaggatcgcctt
ggtctgaaggaaatggacagtcaggggaagctggtcttccttacctccgacactgaccat
ctccagttcagcaaggaatggttcactaagaacctgataccctacatcaaggaatga

DBGET integrated database retrieval system