KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_129598Help
Entry
BRAFLDRAFT_129598 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 3746 aa AA seqDB search
MHLKENQHLTLYVNNNNLRCDKNLTWFICNLPHLHQISVPNALRCASPADLLGAFLATIK
SDVCQNNTDRSEKGRVSTNLDDVFITSPYNDVGCTKHYGMYTTPFIMNISTDNSSDLPST
SDMAASHRTSDGRKPIIINDVNSTYTLAMIGAVVVPFLLVMSLPVAQPKDRSLPVGAEMQ
PKDNDEEKVGNGKPSTSDGKDPYGAEEENENPTVSGIYRSGLQRTGTEGHSASNFLYNPA
HGQHERKDSTSHALFNPAHGQHEGKDSISHALFNLAHGQHADEGRMIAAKPPRMNKDEAL
ALVGFIQTWQQKQCGCCFKDARNVEKFNLLLQGLILVALNIIKTAYQEVKAKQECSSSAK
QEVHVTQGKTEEVKEEEENKEEGTPKKQTEGGEEKTDQDNTGDVAMPEETTEETAKEEAD
DKNEGEREVKKDGMDVRWTLEEREGLLHCVAKIYQMQFPLYTSYKHYFHLSVEDLSQQEG
NALGNYCDMNDVDVPVYLLKNVYHLCEHGGLLLISQCFEQVTPELLPFPLAHAMVALVSN
VRVWLHLPAVMQYILPMRPHVIRLSEKDLRMTGARNMADLMWSAVKEPLDSQMGFDRDSL
ELAFKYFTSPTLTMRLAGLSQVTNQVHVFTEMCNNDSMVDVESNELAEWLVQNKIVEHIF
GPNMHIELKHSSKYVHEVISALIKHLEPALLKHLLKLVSSLHPSQHTEQTLYLASMLTKV
IWSNALSAHMMQQSQQASQPAFTQMLKSTLDKASIHRQADQQSTSSGDNSVSAEPSHSGG
SDAEQENEHMHHHHHHHHVHHGHGEGRERRQGHKPGHRLAQGHEDHEPSSQEESSLEQSL
DVSRETQPSAQSDGSSSGEEGESGQEGSFSSEHSTHSQGSDGSQGSESGRSEESSTEVPT
GRRPRAGRKRADSEQTESTSSEEEESPKQKGSGGKAQKKTVKSKKGSAEKKRLSKGVEDE
SMDVSEKGEKDKGEHVATVPTVDKIAAGNEEEEDDDPPTITSTPQKKKDCSGLTQEEQML
SQTSHSQEMLEDSMETEIYDCRGFIHHTRSNLMEDILSPDEISCSSSQISNKSEKNMADF
EGEDSGCEEELAQINAHAQLSSQMHQHLANMASMYHSHLPHQGHLHHHHHHHHQSPGRHK
KHANEFNFEEVCKPTNTLLWELVQDHSAVHLGEGLAVEAEKLLCSLVCWFTDRQIRMRFI
EGCLENLANNSSVVVSLRLLPKLFGSFQQYRNTYDTHWITMYTHMTEVQARLQFLTFVFS
SLASPETFRLTLEQVDTLWNCLATDPEVGDEALNWFLNQARNKDQHAMSLDTFKHIFVEK
MPGLQPETITMTGLNLFQQLCTLARMVSPSPDMPALDDLGMQQLWGIALRARDPDVSQAA
IQYINNFYINAGNGNLEREHEFVKRCMDSLLKVSATLNRCPGSSLLVLERGLDLLKSHLE
VFRRRYTYHMRMWQLQGRGILSHQKYFNNRNNSKIHVVCQPAGMTDKLTIEMDSQDLVAD
LRAEVTHWFEHLSSQGQVPSSSQDSSAAMAALFGSSLQGPVRMISQGRELTAENMDEKTL
QEMGFKDLQLVFVSVGNPRPQSRRQESFLLPPSLLPEPPRDNLPMLLLLQEPHFDNLMNL
LQLLSTWACPGKEGDSEEVMKAKLALENRGQLLSHKVWELLMLLPTCRDLLNAFTRGIRK
VSPPAEAKDTEAGGSDDQLPADHWSRTLGQDNPHKLLYCLQIIESLSKPRRSRHRSSTGS
QLGGGDQYSVELELPVEGLQVGPAWTQHWQQDTLALLLKLLYHFAMETLEITPSSEDSVF
EADTSGDYETPRKRSRHSRSKKSTGDHEKSSVPKIRSSVLQMMDENPMLERLMSVLYEAA
APSDAGSVLSVYWGKSEVVRHGMRLLVSWVCSVPEVANSLARTKQFQAWLQRLVLDAPEP
TVRREACSGLYKLCMSTTSESHTFIFSLLSALLSFLSAAQLITPPLEPPDDEKGELYGPG
CKDYFWLLCRLVDHAINPEVLHQAQEDNIDIVDVDALARHLAKCISVRKIHEQRHNTVDD
DALCGLLRLCTAVVKHNPPFKYSKHGQELVKVIFECLFKLPTMEDRDQPKCKSQNCRSAA
YDLMVELVKGCLDNYKLLHGKMMAQHTQNVHAPYPWNYWPHEDGRSPCGFVGLTNLGATC
YMASCIQQLYMMPQLRAAILASKVKEDIQNVATLMELQRMFAFLLESERKAYNPRNFCKV
YTMDKQPINTGEQKDMTEFFTDLITKLEEMGPELKDTVKKSFGGVITNNVVSLDCTHVSR
NLEEFYTVRCQVADMKNLYESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPRY
LCFNTMRYTFNMVTMMKEKVNTHFSFPPKLDMSVYTEDYLMGEEGSRQQLDGYEYELIGV
TVHTGTADGGHYYSFIRDRIGSGDKWYLFNDAEVKQFDSTQLASECFGGEMTTKTYDSVT
DKFMDFSFEKTHSAYMLFYERCQPEEERQREMPEKFDLSKDLSEWIWQDNMQFLQDKSIF
EHTYFNFMWQMCSYIPTTLPDPTREVSLLSAKLTASFVLETLIHSKEKPTMLQWIELLTK
HFNSNPQADEWFLDHMAQDDWWPMQILIKCPNQMMRQMFQRLVAHVINQLRPRHAPLYLQ
PVIEGEGSVEDIGCFSCVTRFIKMLLSLLEHGVRPNSKHLTEYFSLLLDFAQKGEEEKHF
MIAIEAISIMANFYLGNKSPDYVEVVSEDEEEEEDDDVITLPEEKYRPTSLEKMIALVAL
LVETSRAERQLSLSQNDLAVLTTGKGFPFLYQQVRDNINLRQTCNLIFSLTRYNPRLAEA
IVSMIFHSIAKLNPDGSQPFFKLLSMLVEFLGGPPGMPSFTQLILNRIWDVTEYNPQQCF
DWLAIQTPRNKLVHSWVLQSMETWAEMYLLASSNIRVRNSAGFLLASLVPNNHFRQMFRS
ARNLHSPNKDIMMTPEATAILHQVYSLLLRLLGRARIYADHTAHGTVKLVQYFALMTYCL
VSRTEKLMLTRYVNDLWQVLHPKLTEPAIPINHNKQALLLFWHHACVDCPENIQLIIQNA
HITKNIPFNYILADHDDQEVVVFNRGMLPAYYAILRMCCQMSAQFARQLASHQNMQWAFK
NLTPHANQYPVAVEELFHLMQLFVARRPEMTKQEQQDIVAFKRATLNCYLNCLEGRSCWT
TLISAFRILLESDEDRLQVACNKGLSLMCESFNTLHLMFHEATACHVTGDLVELLAILYS
ILDTCTKYMDKKEVKQALLQWQEKMELGRKLMTLLNSYTPPEVRQQCFEVLQVLVSLCPR
ECAQSFIPILQHAHANFQRTNVPGIVEHYHMAFTLGPFFPHRGTKAVPNKANIRPPRPDM
QMFLHPNQAEAHRGEDENYDRAMDEFFYPYHKFIDILCRVAANHDLMPDAFINLSALVAY
EGVPLHYTFFPQLWLDIYNSQHIDKTYIKRLMSSPAFADYVDAILMEERVCLNNNTIFSF
FAIFFPRIHSEGVCSQQVVRQSLLDNVVTAIVAEKTSIDTATPEELLKTSRSLNGDLREL
SLLLGVLGQTPLSPMLLPSLQHILATGKRYQQLRDGVAGEAGGDKEEEDKDKECQEKDKE
EKLPASKKGTSKGEGKETTQDSSTEGESDETPVKKMRMSTKSEDTKQQKPNKEPTKAAAK
RAHSPQPSTSAAADQTSPQLSSGTSESGSDSDVSPKAKPVSQRSGQRTGAGKAQDAVDLM
VKLIETNLPLVAANTDSAPPTVGDDK
NT seq 11241 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgaaagaaaaccagcatctgactctttatgtaaacaacaacaacttgcgatgt
gacaagaacctgacgtggttcatctgcaatctaccgcaccttcaccagatttctgtaccc
aacgccctgaggtgcgcatctcccgctgacctcctaggagctttcctcgccaccatcaag
agcgatgtctgtcagaacaacacagataggtcagaaaagggaagggtatccaccaacctt
gatgatgtgttcataacaagtccctacaacgatgtgggctgcaccaaacattatggcatg
tacacaacccctttcatcatgaatatttccaccgataactcttcagacctgccgtctaca
agtgacatggcagcctctcatcgcacatcagatgggagaaaaccgataatcatcaacgat
gtcaacagcacctataccctggccatgatcggtgctgttgttgtgccctttctccttgtg
atgtcattaccagtcgcccaaccgaaggaccggtcactgccagtaggtgcagaaatgcag
ccaaaagataacgatgaagaaaaggtgggaaatggcaaaccatcaacaagcgatggcaaa
gacccttacggagcggaggaagaaaacgagaatccaactgtaagcgggatctacaggagt
ggcttacagcgcactggtacagaaggtcacagcgcatcaaacttcctttacaacccagct
catggacagcacgagagaaaggacagcacatctcacgccctgttcaacccagctcacgga
cagcacgagggtaaggacagcatatctcacgccctattcaacctagctcatgggcagcac
gcggatgaaggacggatgatagcagcaaagccaccacggatgaacaaggatgaggccctg
gcacttgttggcttcatacagacatggcaacagaagcaatgcggctgctgtttcaaagat
gccagaaatgtggagaagttcaacctcctattacaaggacttattcttgtagctttgaac
ataatcaagactgcttatcaagaagtcaaagccaaacaagaatgctcatcttcagcaaaa
caagaagtacatgtaacacaagggaaaacagaagaggtaaaagaggaggaagaaaacaaa
gaagaaggaactcctaagaaacaaactgagggtggggaggagaaaacagaccaagataac
actggagacgtggccatgcctgaggaaacaacagaagagactgctaaagaagaagctgat
gataagaatgaaggagagagggaggttaagaaggatggaatggatgtcagatggactctt
gaagagagagagggccttctgcattgtgtggctaaaatctaccaaatgcagtttcctctg
tataccagctacaagcactactttcacttatcagttgaggacctgtctcaacaggagggg
aatgcattaggaaactactgcgacatgaatgacgtggatgtgcctgtgtacctgctgaag
aatgtttaccacctgtgtgaacacggcgggctgctgctcatcagtcagtgttttgagcag
gtcacccccgagctcctgcccttccctctggcccacgccatggtggccctcgtctctaac
gtccgcgtctggttacacctgcctgccgtcatgcagtacatcctgcccatgagaccgcat
gtcatcagattatcagagaaggacctgcggatgacgggggcgcggaacatggcggacctg
atgtggagcgcggtgaaggaaccgctggactcccagatggggttcgacagggacagcctc
gagctggccttcaagtacttcacctcacccaccctcaccatgaggctggccggcctcagt
caggtcacgaaccaggttcatgtttttaccgagatgtgcaacaacgactccatggtagac
gtggaaagcaatgagcttgctgaatggcttgtacagaataagattgttgaacatatcttt
gggcccaatatgcacatagagttgaaacacagcagcaagtatgtccacgaggtgatctct
gccctcatcaaacatctggagcctgctctgctgaagcacctcctcaaactggtgtccagt
ctgcacccatcacaacacacagaacagacactgtacctggcctccatgctgaccaaggtg
atctggagtaatgcgctgtccgcacacatgatgcagcagtcacagcaggccagtcagcca
gcgttcacacagatgctgaaaagcactctggacaaagcctccatccatcgacaggcagac
cagcagagcaccagtagcggggacaacagcgtgagtgcggagcccagccacagcggcggc
agcgatgctgagcaggagaacgagcacatgcaccaccatcaccaccaccatcacgtccac
cacggtcacggggagggcagggagcgtagacagggccacaagcctggccacaggctggcc
caggggcatgaggaccatgagcccagcagccaggaggagtcttccctggagcagagcctg
gacgtgagcagggagacccagcccagcgcccagtctgacggcagcagcagtggggaggag
ggggagagtgggcaggaggggagcttcagcagcgaacacagcacgcacagccagggcagc
gacgggtcgcagggcagcgagagtggaagatcagaggagtccagcacagaagtgcccact
gggagacgtcccagggcgggcaggaagcgagctgacagtgagcagactgagagcaccagc
agcgaggaggaagagagccccaagcagaaaggctctgggggaaaagcccagaaaaagacc
gtcaaatcaaagaagggttcggcagaaaagaaacggctgtccaaaggggttgaagatgaa
agcatggatgtcagtgagaagggagagaaggataaaggagaacatgttgcgacagtgcca
actgtagataagatagcagcaggaaatgaagaggaggaagatgatgatcctcccaccatc
accagcacaccgcagaagaagaaggactgttcggggctcacacaggaggagcagatgctg
agccagacatcccactcccaggagatgctggaggacagcatggagacggagatctatgac
tgtagaggcttcattcaccatactagaagtaacctaatggaggacatcctgagcccagat
gagatcagctgcagcagctcacagatcagtaacaagtcggagaagaacatggcggacttc
gagggtgaggactctggctgtgaggaggagctggcacagatcaacgctcacgcccagctc
agctcacagatgcaccagcacctggctaacatggcctccatgtaccacagtcacttacca
catcaaggacatctgcaccaccatcaccatcaccaccaccagtctccgggcagacacaag
aagcacgccaacgagttcaactttgaggaggtgtgcaagcccaccaacaccctgctatgg
gagctggtacaggaccatagtgctgtccatctaggagaaggtctggcagtggaggctgag
aagctgctgtgttcgctggtgtgctggttcacagacaggcagatcaggatgcgcttcatc
gagggatgtctggagaacctggccaacaacagttctgttgtggtgtccttaagactgctg
cccaagctgtttggctccttccaacagtacaggaatacctatgatacccactggattacc
atgtacacacacatgacagaagtacaagccaggctccagtttctcaccttcgtcttctca
tcattggcttctcctgaaacattccgtttgacccttgagcaggtggacaccctgtggaac
tgcctggccaccgaccctgaggttggggacgaggccctgaactggttcctgaaccaggca
cgcaacaaggaccaacatgccatgtccctggacaccttcaaacacatctttgtggagaag
atgccaggactccagcctgagaccatcaccatgacaggtctgaacctgttccaacagctg
tgcacattagccaggatggtcagcccatctccagacatgcctgctctggatgacctgggt
atgcagcagctgtgggggatcgccctgagagccagggaccctgatgtcagccaggcagcc
atccagtatatcaacaacttctacatcaatgctggaaatgggaacctggaacgggaacac
gagtttgtgaagaggtgtatggacagtctgctcaaggtgtcagcgacactaaacaggtgc
ccaggttccagtctcctggttcttgagagaggtttggatcttctcaagtctcacctggag
gtcttcagaaggaggtacacgtaccacatgcggatgtggcagctgcagggtcgggggatc
ctcagccatcagaagtacttcaacaacaggaacaactccaagatccacgtggtgtgtcaa
ccagctggcatgacagacaagctgaccatagagatggactcccaggacctggtggctgat
ctgagggcagaggtgacccactggttcgagcacctgtccagtcagggccaggtgcccagc
tcctcccaggactcctctgcagccatggcggccctgttcggcagctccctgcagggtccg
gtgaggatgatctcccaggggagggagctcacggcagagaacatggacgagaagaccctg
caggagatgggcttcaaggacctacagttggtgtttgtgtcggtcggtaaccctcgtccc
cagagcagacgtcaggagagtttcctgctgccgccctccctgctgccggagcccccgcgg
gacaacctgcccatgctgctgctgctgcaggagccgcacttcgacaacctgatgaacctg
ctgcagctgctcagcacctgggcctgccccgggaaggagggggacagtgaggaggtgatg
aaggccaagctggcactggagaaccgaggccagctgctgtcccacaaggtgtgggagctg
ctcatgctgctgcccacctgccgagacctgctcaacgccttcacaaggggcatcaggaag
gtctcccccccagcagaggcaaaggacacagaggcaggaggcagtgatgaccagctgcct
gctgaccactggagccgaaccctgggccaggacaaccctcacaagctcctgtactgtcta
cagatcatcgagtccctcagtaaacctaggaggtccagacatcgctcatcaactgggagc
cagttgggaggaggagaccagtacagtgttgagctggagttgcctgtagaggggctacag
gtggggcctgcctggacacaacattggcagcaagacaccctggcccttctgttaaaactt
ctctaccattttgccatggaaactctggagatcacccccagttctgaagacagcgtgttt
gaggcagacaccagtggagactacgagacccccaggaaacggtctcggcacagcaggagc
aagaagtccacgggagaccacgagaaaagttcagtgccaaagattcgatcctcggttctc
cagatgatggatgagaacccgatgctggagcgactgatgagcgttctgtacgaggcggcg
gctccgagcgacgcgggcagcgtgctgagcgtgtactgggggaagtcggaggtggtgaga
cacgggatgaggctgctggtgtcctgggtgtgcagtgtcccagaagtggccaactcactg
gccaggaccaagcagttccaggcttggctacagagacttgtactggatgcaccagagccc
acagtacgacgggaggcatgtagcggcctgtacaagctgtgcatgtccaccaccagtgag
agtcacaccttcatcttctccctcctgtctgccctgctgagtttcctgtcagcagcacaa
ctcatcactcctccgctagagcctcctgatgatgagaagggtgagctgtacggtcctggc
tgtaaggactacttctggctcctctgccgacttgtggaccatgccatcaaccccgaggtc
ctccaccaggctcaggaggacaacattgatatcgtagatgtggacgcgctggcgagacat
ctggcaaaatgtatctctgtgagaaagatccacgagcagagacacaacaccgtggatgat
gacgctctgtgcgggttgctgagactctgcacggccgtggtgaagcacaatcctccgttc
aagtactccaagcacggtcaggagctggtgaaggtgatattcgagtgtctgttcaaactg
cccaccatggaagacagggaccaacccaagtgcaagtcgcagaactgccggtcggcggcg
tacgacctcatggtggaactggtgaagggctgtctggacaattacaagctgcttcacggg
aagatgatggctcagcacacgcagaacgtgcatgctccgtacccgtggaactactggccg
cacgaggacgggcgttccccgtgcggttttgttggattgaccaatctgggcgctacgtgc
tacatggcttcctgtatacagcagttatacatgatgccccagctgagggcagccatttta
gcttccaaggtcaaagaggacatacagaatgtggccacgctgatggagcttcaaagaatg
tttgcattccttctggagagtgagcggaaagcgtacaaccctagaaacttctgtaaggtg
tacaccatggacaaacagcccatcaacactggagagcagaaagacatgacagagttcttt
accgatctcatcaccaaacttgaggaaatgggacctgagctgaaggacactgtaaagaaa
tccttcggtggtgtgatcacaaataacgtggtgtctttagactgcacacatgtcagtcgt
aacttggaggagttctacactgtgaggtgccaagtagcagatatgaagaatctgtatgag
tcgttagacgaggtgactgtgaaggacacactggagggggacaacatgtacacgtgctcc
cagtgcggcaagaaagtgcgcgcagagaagcgggcgtgcttcaagaagcttcccaggtac
ctgtgcttcaacaccatgaggtacacgttcaacatggtgacgatgatgaaggaaaaagtc
aacacacacttctcgttcccccccaagctggacatgagcgtgtacacggaagactatctc
atgggggaggagggcagcaggcaacagctagacggctatgagtatgaacttataggtgtg
accgttcacacgggaacggcagacggggggcactactacagcttcatcagggacaggata
gggtcgggtgacaagtggtacctttttaacgatgcagaggtcaagcagtttgattccaca
cagcttgcctcagaatgcttcgggggagagatgacgacaaagacgtacgactcggtcacg
gacaagttcatggacttctcgttcgagaagactcacagcgcttacatgctgttctacgag
agatgccagccggaggaggagcggcagagggaaatgcccgaaaagtttgacctgtccaag
gacctgtcggagtggatatggcaggacaacatgcagttcttgcaggacaagagcatcttc
gagcacacctacttcaacttcatgtggcagatgtgcagctacattcccaccaccctgccg
gaccccaccagggaagtgtccctcctgtccgccaaactcaccgcttcctttgtgctggag
actctgatccattccaaggagaagcccaccatgctgcagtggatcgagctgttgaccaaa
cacttcaactccaatccccaggccgacgagtggttcctggaccacatggcccaggacgat
tggtggccgatgcagatcttaatcaagtgcccgaaccagatgatgcggcagatgttccag
agattagtggcgcacgtgatcaaccagctcagacctcgacacgccccgttatatttacag
cccgtgatagaaggggaggggagtgtcgaggatatcggttgtttctcctgtgtgacaaga
ttcatcaagatgctgctgagtctgctcgagcatggtgttcggcccaacagcaaacacttg
acagaatacttctccctgctgctggactttgcacagaaaggggaggaggaaaaacacttc
atgattgccatagaggccatctccatcatggccaacttttacctgggcaacaagtctcct
gactacgtggaagttgtgtctgaggatgaggaggaggaagaggatgatgatgtcatcacg
ctgccggaggagaagtaccgccccacgtcgctggagaagatgatcgccctggtggccctg
ctggtggagacgtcccgcgctgagaggcagctcagcctgtctcagaacgacctggccgtg
ctaactacaggaaagggattccccttcctgtaccaacaagtacgggacaacatcaacctg
cggcagacgtgtaacctgatcttcagtctgacccggtacaacccgcggctggcggaggcc
atcgtgtccatgatcttccactccatcgccaagctgaacccggacggctcccagcccttc
ttcaagctgttgtccatgctggtggagttcctggggggtcccccgggcatgccgtccttc
acacagctcatcctcaacaggatatgggatgttactgagtacaacccacagcagtgtttt
gactggctggctatccagaccccacgtaacaagctagttcacagctgggtgctgcagtcc
atggagacatgggcagagatgtacctcctggcctccagtaacatcagggtcaggaactct
gctggtttcctgttggcctccctggtccccaacaaccacttcagacagatgttccgctcc
gcacggaacctccacagccccaacaaggacatcatgatgacccctgaggccaccgccatc
ctacaccaggtgtactccttgctcctgcgcctgctgggtcgtgcccggatctatgctgac
cacaccgcccatggaaccgtcaaacttgtgcaatactttgccctgatgacttactgctta
gtgtccagaacagagaagctcatgttgaccaggtatgtgaacgacctgtggcaggtgtta
catcctaagctgacagagccagccatccccatcaaccacaacaaacaggccctgctgctg
ttctggcatcatgcctgtgtggactgcccagaaaacattcagctcatcattcagaatgca
cacatcaccaagaacattcccttcaactacatactagcggaccatgatgaccaggaggtg
gtggtgtttaaccgcggcatgctgcctgcatactacgccatcctgcgcatgtgttgtcag
atgtctgcccagttcgcccgtcagctggcctcgcaccagaacatgcagtgggccttcaaa
aacctcacaccgcacgccaaccagtaccctgtggctgtagaagagctgttccacttgatg
cagctgtttgttgccaggcgaccagagatgaccaagcaggaacagcaggacatcgtggcc
ttcaaacgtgccactctgaactgctacctcaactgtctggagggcaggtcctgctggacc
actctcatcagtgcattccgcatcctgctggagagtgatgaggacaggcttcaggtggcc
tgcaacaaggggctcagtctcatgtgtgagtccttcaacacgttacacttgatgttccac
gaggcgacggcctgccatgtgacgggagacctggtggaactgttagccattctctactcc
atactggacacctgcaccaagtacatggacaaaaaagaagtaaagcaggccctcctacag
tggcaggagaaaatggaactgggcaggaaactcatgaccctgctcaactcctacacccct
cctgaagtcagacaacagtgctttgaggtgcttcaggttctggtgtccctgtgtccacgt
gagtgtgcccagagcttcatccccatcctgcagcacgcccacgccaacttccagagaacc
aatgtgccaggtattgtggaacactaccacatggcattcaccctcggaccattcttcccc
caccgtgggacaaaggctgttcccaacaaggccaacatccgccctccccgccctgacatg
cagatgttcctccatccaaaccaggccgaggcacacaggggtgaggatgagaactatgac
agggcaatggatgagttcttctacccgtatcacaagttcatcgacatcctgtgtcgggtg
gcagcgaaccatgacctcatgcctgatgccttcatcaacctcagtgctttggtggcctat
gaaggagtccctctccattacaccttcttccctcagttatggctggacatctacaactca
cagcacatagacaagacctacatcaagaggctgatgtcgtccccagcatttgctgactat
gttgacgcaatcctgatggaggagcgggtctgccttaacaacaacaccatcttctccttc
tttgccatcttcttcccaaggatccactcggaaggcgtgtgcagccagcaggtggtgagg
cagtccctgctggataacgtggtcacagctatcgttgcagagaagaccagtattgacact
gccacaccggaggagctgctcaaaacctcccgcagcctcaatggggacctgcgtgagctg
tccctcctgctaggggtattgggtcagactccccttagccccatgctgctccccagtctg
cagcacatcctggcaacaggcaagcgctaccagcagctacgggacggggtggcaggggag
gccgggggggacaaggaggaggaggacaaggacaaggagtgccaagaaaaggacaaggaa
gagaagctgccggcttctaagaaggggacaagtaaaggtgaagggaaggaaaccactcaa
gactcaagtactgagggtgagagtgatgaaacacctgtaaagaagatgagaatgagcaca
aagtcagaggacaccaagcagcaaaaacctaacaaggaaccgaccaaagcagcagccaag
cgtgcgcactcgccgcaaccgtccacttcggctgccgcagaccagacgtcaccacagctc
agcagcgggacctccgagtcgggaagcgactcggacgtctcccccaaagccaagccggtc
agccagcggtcagggcagagaacgggcgcgggcaaggctcaggatgcggtggatctgatg
gtgaagctgatagagaccaacctgccactcgtcgcagcaaacacggactcagcacctcca
acagtcggcgatgacaagtga

DBGET integrated database retrieval system