KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_130664Help
Entry
BRAFLDRAFT_130664 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K10886  
DNA-repair protein XRCC4
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:bfo03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 326 aa AA seqDB search
MRTLCKLQAGGQPYYLLTNVVQNGREGFQLTLCDGLSAWAGQVDGEDMKEMADESGMEFE
TFVAESVRALTRENMGDITFHYSVEIQEEDVTCRQFSWKKYIPSEKVRFQLGSMKLREAA
SPGEAMQQIFDHALGKVEELRHTISDVQKEKDRLSGERTKALERLEKYVAQKEEMEGDLY
AKFVVVVNDKKAKIRQLKDELAQAREMAATQQSRKVSQTTKRDAPSGSSEDNDTDKNPDS
EDEEDGNTTDEERPKRKVWRNTAGGGGDLDLELGGEDEGGADLEPAAKRSSDRSSPSGVP
RIPSRQSSGRSNRSGDLDPDDLFDEL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccctgtgtaaactgcaggcaggaggccagccctactacctgctgactaatgtg
gtacagaatggcagggaagggttccagctcaccctgtgtgatggactgtcagcatgggct
ggacaggttgacggggaagacatgaaggagatggcagacgagtccgggatggagtttgag
acgttcgttgcggagagcgtgcgggcgctgactcgggaaaacatgggtgacatcaccttt
cactactctgtggagatacaggaggaggatgtcacatgtagacagttctcttggaagaag
tacataccatcagaaaaagtcaggttccagttgggcagtatgaagttgcgagaggcagcc
agtcctggcgaggcaatgcagcagatatttgaccacgccctgggtaaggtggaggagctg
agacacaccatctctgatgtacagaaggagaaggacagactgtccggggagaggaccaag
gcactggagaggctggaaaagtatgtggcacagaaggaagaaatggagggagacctgtac
gccaagtttgttgttgtcgtcaacgacaagaaggccaaaatccgtcagctgaaagacgag
ttggcgcaggcaagagaaatggcagctacgcaacaatccagaaaagtcagccagaccaca
aaacgagacgccccatcagggtcatcagaagacaatgacacagacaagaaccctgatagt
gaagatgaagaagatggaaacacgacagacgaggaacggccgaagaggaaggtgtggagg
aacactgcagggggtgggggcgacctcgaccttgagctgggaggggaagacgaaggaggg
gccgaccttgaacctgctgctaagagatccagtgataggtcctccccttcaggagtaccc
agaattcccagccgccaatcatctggcagatccaacaggtcaggtgaccttgatccagat
gacctttttgatgagttgtga

DBGET integrated database retrieval system