KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_131352Help
Entry
BRAFLDRAFT_131352 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BRAFLDRAFT_131352
Messenger RNA biogenesis [BR:bfo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     BRAFLDRAFT_131352
Translation factors [BR:bfo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    BRAFLDRAFT_131352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 697 aa AA seqDB search
MADERERGGRDRNQSESASLGGSEDQESFVNGHDEPDFSDPEDYVDNISDEELLGDLLKQ
KPKEADGIDSVIVVDNVPQVGPERLEKLQNVIRKIFSKFGKIVSEYFPEGDNGKTKGYIF
LEYSSPANALEAVRNCNGYKLDKQHTFAVNLFSDFDKYSGIPEEWEPPEQQPYKDPGNLW
YWLEDAECNDQYSVIYDGGERTAIFQNTYGGTEQALVEERARWTETYVRWSPKGTYLATF
HQRGIALWGGEKFRQIQRFSHQGVQLIDFSPCEKYMVTFSPLIDSKDEPQAIIIWDINTG
VKKRGFHCENAAQWPIFKWSADGKYFARMGQDSLSVYETPSFGLLEKKSSKIPHIREFFW
SPTDNIIAYWTPEKDNIPARVTLLEIPSRQEIRTKNLFSVADCKIYWQKQGDYLCVKVDR
YTKSKKGLFYNLELFRMREKQIPVDVVEVKEVVNAFAWEPNGEKFVVLHGESPRISASIY
KMSGKVELLKCLEKKQANHLFWSPQGQFVVLAGLRSMNGALEFIDTNDMTVMNVAEHFMA
TDVEWDPTGRYVITAVSWWGHKVDNAFWLWSFQGRLLHKQNLDRFCQLLWRPRPPSPLTA
SQIKKIKKNLKQYQKQFEIKDKMRMSKASKELVEKRHALMQDFEKYRKKKRELNRQQKEQ
RLALRGGVDTDRLDSESDVEDEKVEFFVKEETIVLSK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaaagagaacgtggtggccgcgacagaaatcagtctgaatccgccagttta
ggcggcagcgaagatcaggaatccttcgtcaacggccacgatgaaccagacttcagtgat
ccagaagattacgtggacaatatttcggacgaagaactcctcggagacctccttaaacag
aaacccaaggaggcagatggcattgactcagtcatagtggtagacaacgtgcctcaggtt
gggcctgaacgactggagaaactccagaatgtcatcaggaagatcttctccaagtttggc
aagatcgtgagcgagtacttcccagagggagacaatggcaagacaaaggggtacattttc
cttgagtactcatccccagccaacgcccttgaagccgtgcggaactgtaacgggtacaaa
ctggacaaacagcacacctttgctgtcaacctattctccgactttgacaagtactctggc
attcctgaggagtgggagccaccagagcaacaaccctacaaagatccaggtaacctgtgg
tactggctggaggatgccgagtgtaacgaccagtacagcgtgatctacgatggcggggaa
aggacggccatcttccaaaacacgtacggtggcaccgaacaggcactggtggaggaacga
gctaggtggactgagacatatgtacgctggtcgcctaaaggcacgtacctggcaacgttt
caccaacgcggcatcgctctgtggggaggagagaagttccgacagatccagcgattcagt
catcaaggagttcaactgatagacttctctccttgtgaaaagtacatggtgaccttcagc
cccctgattgacagtaaggatgaaccccaggccatcatcatctgggacatcaacacaggt
gtgaagaagagaggcttccactgtgagaatgctgcacagtggcccatcttcaagtggagc
gctgatgggaagtactttgctaggatgggacaggacagtctcagtgtgtacgaaacaccg
tcattcggtctcttggaaaagaagagtagcaagattcctcatataagagagttcttctgg
tctcccacggacaacatcatcgcgtactggaccccggagaaggacaacatcccagcccgc
gtcaccctgctggagatcccgtctcgtcaggagatccgcaccaagaacctgttcagcgtg
gccgactgtaagatctactggcagaagcagggagactacctgtgtgtcaaggtggaccgc
tataccaaaagcaaaaagggcctgttctataacctagagttgtttaggatgcgagaaaaa
caaatcccagtggacgttgtggaagtgaaggaggtggtgaatgcctttgcctgggagccc
aatggggagaagtttgtagttctccatggagagtctccccggatcagtgccagcatctac
aagatgtccggcaaggtcgagcttctcaaatgcttggagaagaaacaggccaatcacctg
ttctggagcccacagggacagtttgtggtgctggcgggtcttcgcagcatgaatggtgct
ctggagttcattgataccaacgacatgacagtaatgaacgtggcggaacacttcatggcc
accgacgtggagtgggacccgaccgggcgctacgtcatcacggctgtgtcgtggtgggga
cataaggtggacaatgccttctggctgtggtcattccaaggacgtctgttacacaagcag
aacttggaccgcttctgtcagctgctgtggcgcccgcggcccccctcccccctcaccgcc
tcccagatcaagaagatcaagaagaacttgaagcagtaccagaagcagtttgagatcaag
gacaagatgaggatgtccaaggcctccaaggaattggttgagaagcgccatgctctgatg
caagactttgagaagtaccggaaaaagaagcgtgagctgaaccgtcaacagaaggaacag
cgcttggcactacgaggaggtgtggacactgatcgtctggacagtgaatccgacgtagaa
gacgagaaagttgagttctttgtcaaggaagagaccatcgtcctcagcaaatag

DBGET integrated database retrieval system