KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_132295Help
Entry
BRAFLDRAFT_132295 CDS       T01074                                 

Definition
cAMP-dependent protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:bfo04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:bfo04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 369 aa AA seqDB search
MAAKATPKGSGHGKATAIGKISKGHGDGSYSDSVKEFLAKAKEDFTKKWESPSQNTAALD
EFDRLKTLGTGSFGRVMLVQHKATQNFYAMKILDKQKVVKLKQVEHTLNEKRILQAISFP
FLVSLEFHFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEQHSRFYAAQIVLTFEYLHSLD
IIYRDLKPENLLIDQLGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDW
WALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRY
GNLKNAVNDIKNHKWFQTTDWILVYQRKVEAPFIPKCKGPGDSSNFDDYEEEPLRISATE
KCAKEFHDF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaagcgacgcccaagggaagcggccacggcaaggcgaccgccatagggaaa
atctctaaaggccatggtgatggctcgtactcagacagtgtgaaagagttccttgcaaaa
gccaaagaagacttcaccaagaaatgggagagtccatcacagaacacagcggcgctggat
gaatttgaccggctgaagacgctgggaacggggtcgttcggccgcgtcatgttggtgcaa
cataaagccacgcaaaacttctacgccatgaagatacttgacaaacagaaggttgtaaaa
ttgaagcaggttgagcacacgctgaatgagaagcgaatcctgcaggccattagcttcccc
ttccttgttagcttagagttccacttcaaggacaactccaatctctacatggtgctggag
tatgtaccgggtggagagatgttctcccatttacgacggataggaagattcagtgagcag
cactccaggttctatgcagcccagattgtgctgacgttcgagtacctgcattccttggac
atcatctacagggacttgaagccagagaacttacttatagaccagctgggctacctcaag
gtgacagattttgggtttgcgaagcgggtgaaagggagaacgtggacgctgtgtggaaca
cctgagtacctggccccagagattatcctcagcaagggctacaacaaggcagtagactgg
tgggcgctgggcgtgctggtgtatgaaatggcggccgggtatcctcccttctttgccgac
cagcccatccagatctacgagaagattgtttcagggaaggttcgcttcccgtcccacttc
agctcggacctgaaggacctactgcggaacctgctgcaggtggacctgaccaagcgctac
ggcaacctgaagaacgccgtcaacgacatcaagaaccacaaatggttccagaccacggac
tggatcctggtctaccagcggaaggtcgaagctcccttcatccccaagtgcaaaggtccc
ggggactccagtaactttgatgactatgaagaggaacctctccgcatctccgcaacagaa
aagtgtgcaaaggagttccacgatttctga

DBGET integrated database retrieval system