KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_198826Help
Entry
BRAFLDRAFT_198826 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00860  Porphyrin and chlorophyll metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_198826
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BRAFLDRAFT_198826
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BRAFLDRAFT_198826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox Thi4 MCRA Pyr_redox_2 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 GIDA
Motif
Other DBs
NCBI-GeneID: 7208280
NCBI-ProteinID: XP_002588417
JGI: 198826
UniProt: C3ZSM6
AA seq 475 aa AA seqDB search
MTSVAVIGGGISGLSAAYYLSKAPHLVNKVVLLEGSSRLGGWLQSTRTEEGAIFEHGPRS
LRVAGEPGANILGMADDLGLTDQILPVLPSHEGAKNRFIYAGGKLHKLPSNFRWVSPTNI
PVPVCGHRHVCEGREEEGDESVHSFFCRRLGKQFTDNAIDPMVRGIYGGDCRQLSVQALF
PSIQQAERRKGSITRGLLFGPKKKESPLKVDSELLKKARQERWALWSLKDGLEALSNSLQ
EYLMKSGVELLTDRRVETLEFDTTNQVNTLDEQLQVNHVISAVPSQCLSQMFAGNHPILS
ENLSVNPSATIGLVNLEFSGSVLPSEGFGYLVPSGQPERILGAVFDSSIFPQHNRPNSAT
TRLTVMMGGTWFCEQFGDPNEVDTSLLLDVALETMSRHLNITSSPLRSFTTIQKDCIPQY
TLGHTDRLEQMESYIAEKRLPLSLVGCSYRGVGVNDCVLDARKAVTNLLKTHERD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctgtggccgtgattggaggtgggatctcaggactgtcggctgcctactacctc
agtaaggctccacacctggtcaacaaggttgttctccttgagggaagttcccgcctgggt
ggctggctccagtccaccaggacagaagaaggagcgatattcgaacacggccctcgcagt
ctccgggtggcgggagaaccgggggcaaacatccttgggatggcggatgaccttgggttg
acagaccagatcctgcccgtccttccgagccacgagggagcgaagaaccgtttcatctac
gctggcgggaaacttcacaaactgcccagcaacttcaggtgggtgtctcccaccaacatc
ccagtgccagtatgtggacatcgacatgtttgtgaagggagggaggaggagggggatgag
agtgtgcacagcttcttctgtaggaggctggggaaacagtttacagacaatgccattgac
ccgatggtccgtgggatctacggcggcgactgtcggcagctgagcgtccaggcgctgttt
cccagcatacaacaggcagagaggcggaaggggtccatcacaagagggctgctgtttggg
ccgaagaaaaaagaatcaccccttaaggtagacagtgagctccttaagaaggcaaggcag
gagagatgggccctgtggtcgctgaaggacggtcttgaggcactgtctaactccttacag
gaatacctgatgaaaagtggggtggaacttcttacagacaggagggtggagacgctggag
tttgacacaaccaaccaggtgaacacccttgatgaacagctgcaggtgaaccatgtcata
tctgcagtgccaagtcaatgtttgtctcagatgtttgctggtaatcatcccattctatct
gaaaacctgagcgtgaatccgtccgccacgatcggcttggtcaacctggagttctcagga
tctgtgctgccctctgagggatttggttacctggtgccatcaggacagccagagaggatt
ctgggagctgtgtttgactcctccatcttcccacagcacaaccgtcccaacagcgccacc
acgaggcttacggtgatgatgggaggtacctggttttgtgagcagttcggcgaccctaac
gaggtcgacacatcccttctcctggacgttgccttggaaaccatgagccgacacctaaac
atcacgtccagcccgctgcggtctttcactactattcagaaggattgtataccacagtac
acacttggacacacggacagattagaacaaatggagtcatacatagcagagaagagacta
ccgctgagcctggtcggttgctcgtaccgaggggttggggtgaacgactgcgtacttgat
gccagaaaagctgttacaaacttgttgaagactcatgaaagagactga

DBGET integrated database retrieval system