KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_198826Help
Entry
BRAFLDRAFT_198826 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_198826
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BRAFLDRAFT_198826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 475 aa AA seqDB search
MTSVAVIGGGISGLSAAYYLSKAPHLVNKVVLLEGSSRLGGWLQSTRTEEGAIFEHGPRS
LRVAGEPGANILGMADDLGLTDQILPVLPSHEGAKNRFIYAGGKLHKLPSNFRWVSPTNI
PVPVCGHRHVCEGREEEGDESVHSFFCRRLGKQFTDNAIDPMVRGIYGGDCRQLSVQALF
PSIQQAERRKGSITRGLLFGPKKKESPLKVDSELLKKARQERWALWSLKDGLEALSNSLQ
EYLMKSGVELLTDRRVETLEFDTTNQVNTLDEQLQVNHVISAVPSQCLSQMFAGNHPILS
ENLSVNPSATIGLVNLEFSGSVLPSEGFGYLVPSGQPERILGAVFDSSIFPQHNRPNSAT
TRLTVMMGGTWFCEQFGDPNEVDTSLLLDVALETMSRHLNITSSPLRSFTTIQKDCIPQY
TLGHTDRLEQMESYIAEKRLPLSLVGCSYRGVGVNDCVLDARKAVTNLLKTHERD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctgtggccgtgattggaggtgggatctcaggactgtcggctgcctactacctc
agtaaggctccacacctggtcaacaaggttgttctccttgagggaagttcccgcctgggt
ggctggctccagtccaccaggacagaagaaggagcgatattcgaacacggccctcgcagt
ctccgggtggcgggagaaccgggggcaaacatccttgggatggcggatgaccttgggttg
acagaccagatcctgcccgtccttccgagccacgagggagcgaagaaccgtttcatctac
gctggcgggaaacttcacaaactgcccagcaacttcaggtgggtgtctcccaccaacatc
ccagtgccagtatgtggacatcgacatgtttgtgaagggagggaggaggagggggatgag
agtgtgcacagcttcttctgtaggaggctggggaaacagtttacagacaatgccattgac
ccgatggtccgtgggatctacggcggcgactgtcggcagctgagcgtccaggcgctgttt
cccagcatacaacaggcagagaggcggaaggggtccatcacaagagggctgctgtttggg
ccgaagaaaaaagaatcaccccttaaggtagacagtgagctccttaagaaggcaaggcag
gagagatgggccctgtggtcgctgaaggacggtcttgaggcactgtctaactccttacag
gaatacctgatgaaaagtggggtggaacttcttacagacaggagggtggagacgctggag
tttgacacaaccaaccaggtgaacacccttgatgaacagctgcaggtgaaccatgtcata
tctgcagtgccaagtcaatgtttgtctcagatgtttgctggtaatcatcccattctatct
gaaaacctgagcgtgaatccgtccgccacgatcggcttggtcaacctggagttctcagga
tctgtgctgccctctgagggatttggttacctggtgccatcaggacagccagagaggatt
ctgggagctgtgtttgactcctccatcttcccacagcacaaccgtcccaacagcgccacc
acgaggcttacggtgatgatgggaggtacctggttttgtgagcagttcggcgaccctaac
gaggtcgacacatcccttctcctggacgttgccttggaaaccatgagccgacacctaaac
atcacgtccagcccgctgcggtctttcactactattcagaaggattgtataccacagtac
acacttggacacacggacagattagaacaaatggagtcatacatagcagagaagagacta
ccgctgagcctggtcggttgctcgtaccgaggggttggggtgaacgactgcgtacttgat
gccagaaaagctgttacaaacttgttgaagactcatgaaagagactga

DBGET integrated database retrieval system