KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_199312Help
Entry
BRAFLDRAFT_199312 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     BRAFLDRAFT_199312
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   BRAFLDRAFT_199312
Spliceosome [BR:bfo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    BRAFLDRAFT_199312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 409 aa AA seqDB search
MCFSSRYKDDSYYRHSSTGHHSSHHSHRRHRKRRKRHHHSRSQSHSDSRGKSVQDDEEGH
LIYHHGDWLQARYEIVSTLGEGTFGKVVECVDHQRGRKSIALKIIKNIEKYREAAKLEIN
VLEKLADKDPSNKFLCVQMLDWFDYHGHMCISFDMLGLSVFDFLKENSYMPYPLHQVRHI
AYQMCYAVKFLHDNKITHTDLKPENVLFVDSSYDMFYNTEKKRDERYVKNTDIRLIDFGS
ATFDWEHHSTIVSTRHYRAPEVILELGWAQPCDVWSIGAIIFELYLGFTMYQTHDNREHL
AMMERILGPMPSKLIKKTRKQKYFYKSRLDWDESSSAGRYVRENCKPLRRYMLVNDKEHE
ELFDLISQMLTYDPSKRITLSEALSHPFFALLPPEQRLGRREHSHSLSR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttagttccaggtacaaggatgacagctactaccgccacagcagcactggtcac
cactccagccaccacagccaccgaagacaccgcaagcgaagaaagcgccatcaccacagc
aggtcacaatcccactccgactcgagaggaaagagcgttcaagacgacgaggagggtcat
ttgatatatcaccatggagactggctgcaagcgagatatgagattgttagtactttaggt
gaaggtaccttcggcaaagtcgtggaatgtgtcgaccaccaaagagggaggaaaagcata
gcgctgaagataatcaagaacatcgagaagtaccgagaagcagcgaagcttgagatcaac
gtgctggagaagctggccgacaaggatcccagcaacaaattcctatgtgtgcagatgctg
gactggtttgactaccacggacacatgtgcatctccttcgatatgctgggactaagtgtc
ttcgacttcctgaaagagaacagctacatgccctacccgctacatcaggttcgacacatc
gcctatcagatgtgctacgcagtcaaatttctccatgacaacaagataacccacaccgac
ctgaagccagagaacgtcctcttcgtagactcttcatatgacatgttctacaatacagag
aagaagagagatgagagatatgtgaagaatacagacatccggctgattgattttggttct
gccacgtttgactgggaacaccacagtaccatcgtctccaccaggcactacagagcacca
gaggtcattctggagttgggctgggcccagccgtgtgacgtctggtccatcggtgccatc
atctttgaactgtacctgggcttcaccatgtaccagacacatgacaacagagagcacctg
gctatgatggaacgtatcctgggaccaatgccctccaaactaatcaagaagacaaggaag
cagaagtacttctacaagtcccggttagactgggatgagtccagctcggcaggaagatat
gtgagggaaaactgcaaacctctacggcgctacatgcttgtgaacgacaaggaacacgag
gaactcttcgacctcatctcacagatgctgacctacgacccctccaaacgcatcacgcta
tccgaggccctcagtcaccccttcttcgccctccttccgcccgagcagcgcctcggcaga
cgggaacactcgcacagtctcagcagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system