KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_200926Help
Entry
BRAFLDRAFT_200926 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Chromosome [BR:bfo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    BRAFLDRAFT_200926
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_200926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 7212290
NCBI-ProteinID: XP_002595657
JGI: 200926
UniProt: C3Z773
AA seq 121 aa AA seqDB search
MPAKGAKGAKKAGKGRPMGKGGKNKRRRRRETFGIYIYKVLKQVHPDTGVSSKAMGIMNS
FVNDIFERIAGEASRLAHYNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaagggagcaaagggagccaagaaggccggcaagggccgcccaatgggtaag
ggtggtaagaacaagaggaggaggaggagggagaccttcggtatctacatctacaaggtg
ctcaagcaggtgcaccccgacaccggtgtctcaagcaaggctatgggcatcatgaactcc
ttcgtcaacgacatcttcgagcgtatcgctggcgaggcttcccgcctggctcactacaac
aagcgctccaccatcagcagccgagagatccagaccgccgtgcgtctgctgctgcctggt
gagctggccaagcacgccgtcagcgagggcaccaaggccgtcaccaagtacaccagctcc
aagtaa

DBGET integrated database retrieval system