KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_201414Help
Entry
BRAFLDRAFT_201414 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     BRAFLDRAFT_201414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 331 aa AA seqDB search
MTLFFHHIFSRRGSNVSLSIDLPMPPLSADSVKCGTPPKESIVDELLQSGTRKMTRAELR
QSILNAKALYGEFWEIPMNHPEQVEIPGCGTKNRYKTILPNAHSRVVLPEVDNDLLTTYI
NANYVKGYDMEERSYIATQGPMNHTVTDFWQMVWQERTPIIVMITKLTEKNEKCAHYWPD
LEDRYGDIVVSVNRVVEHDGYILRHFTLQRGNEVHYIRHYWCTEWPDHKTPETAKALLAL
VQEVEFHRLRQTRPRRPVVVHCSAGIGRTGCFIATSIGIRQLREENTVDVLSIVCGMRQD
RGGMVQTNEQYEFIHYALCQFEKTLPSEGVD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacattgttttttcaccacattttttccaggaggggctccaacgtgtccctgtccatt
gacttgccgatgcctccactgtctgcagactctgtcaaatgtggcacgccaccgaaggag
agtattgttgatgagctgctccagtcagggaccaggaagatgacacgggcagagctgaga
cagtccatcctcaacgctaaggctctgtatggggagttctgggagatccccatgaaccac
cctgagcaggtggagattccagggtgtgggaccaagaacagatacaagactatcctgcca
aatgcccactccagagtggttctcccagaagtggacaatgaccttcttactacatatatc
aatgcaaactatgtcaagggttatgacatggaggagcgatcgtacatcgccacgcagggt
ccgatgaaccacacggtgaccgacttctggcagatggtgtggcaggagaggacacccatc
atcgtcatgatcaccaaactcacagaaaagaacgagaaatgtgcccactactggcctgac
cttgaggacagatacggtgacattgtggtgtctgtgaacagggtagtggagcatgatggg
tacatcctcagacacttcacgctccagcgaggaaacgaggtccactacatcaggcactac
tggtgcacggagtggccggaccacaaaaccccggagacggcaaaggctctgctggcattg
gtgcaggaggtggagttccacagactcagacagactaggcccaggagaccggtcgtcgtg
cactgcagtgctgggatcggtcgcaccggttgtttcatcgccacaagcatcggaatccgg
cagctgagagaagagaacacggtggacgtgctgagtattgtctgcggcatgcggcaagac
agaggaggaatggtccagaccaatgagcagtacgagttcatccactacgctctgtgccag
ttcgagaaaaccctaccctctgagggggtcgactga

DBGET integrated database retrieval system