KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_202613Help
Entry
BRAFLDRAFT_202613 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BRAFLDRAFT_202613
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    BRAFLDRAFT_202613
   04070 Phosphatidylinositol signaling system
    BRAFLDRAFT_202613
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     BRAFLDRAFT_202613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1033 aa AA seqDB search
QESSSVEFNCTFKTDEYGFFLYWKAEGKEGQVLEISTVNDVRPGAQAKDGKVLLDDKSIE
ELESDDKGPIDDRSITVVSAEDMVNLSIMYMVADDAKTAMTWREGIRGLLHNYKANNVCP
MTQFQKHWMRLSLQVSPSGKIPVRSITRTFASGKTEKMVFQSLKDLGLPNGKNDEIEPAD
FTFEKFFELYKKICPRTDIDDLFHKLNGGKEYLTVDQIIKFLNEQQRDPRLNEILFPFFD
RKRVVALIQKYEVDPEFTKKEWMSVEGFTRYLMSDENAPVFLDRLEEYQDMDQPLCHYYI
NSSHNTYLTGRQFGGKSSVEIYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTDVL
FKDVIHAIAETAFEASDYPVILSFENHCCKAQQYKLAKYCDEIFGDLLLKEPLEDYVLEE
GKDLPPPNALKRKILIKNKRLKPEMEKKQLELFWKGEGNLEVEEEEHSESECFLLSGENG
VSSPSEDGNPQEFKFNKSNSSSDIQEEGKNGSLKNKKVEMLEEEQAMAMAQYQYQGATTN
VHPWLSSMVNYAQPVKFAGFDVAEDRNIHHNMSSFNESACLGYLKTSAIEFVNYNKRQMS
RIYPKGARVDSSNYMPQIFWNAGCQMVALNYQTPDLSMQLNQGKFEYNGKCGYLLKPEFM
RRPDKTFDPFAESPVDGVIAATIEVEVISGQFLSDKKVGTYVEVEMYGLPTDTIRKEFKT
KTIPANGLNPQYNEEPFVFRKVVLPDLATLRFAVYDENNKLIGQRVLPLDGLQAGYRHVG
LRTESNFPMSLPCLFCNINLMTYVPDGLGEFVDALNNPMQYLSQLEKRAMAMKAMGIDEK
DIADVPASSGKKDKKAANGKSPATPSSSLGVDGKDGKAKTPTKVSIESLKQEKQYIKLIK
KQTKEMNGLKKRHDKEKAVMQKAQSSVVDKMVAAHQKEKQSVEKNLEKAKKKNGTNAAEL
ESKLKSLVENHDAKVKEIVATQTKDFSELVAKCSKEEHEVKEGHFKQQCDVLKQLMKVAH
EQQTKQITTIHEK
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
caggagtcatcttcagtggaatttaactgcaccttcaagactgatgagtatggcttcttc
ctctactggaaagcagaaggcaaggaaggacaagtcctggagatttctacagtaaacgat
gtgagacctggcgctcaagcaaaggatgggaaggttctcttggatgacaagtcgattgag
gagctggagtctgatgacaaaggaccgatcgatgatcggtccatcactgttgttagtgca
gaagacatggtcaacctgagtatcatgtacatggtggccgatgatgcaaaaactgccatg
acatggagggaagggatacgtggccttctccataactacaaggcaaacaatgtgtgtcca
atgacacagtttcaaaaacactggatgaggctctccctccaggtcagccccagtggcaaa
attcctgtcagaagtatcacaagaacatttgcctctggcaaaacagagaagatggttttt
cagagtctgaaggaccttggacttccaaatggaaagaacgacgagattgagccggcagac
tttacttttgagaagttctttgagctgtataagaagatatgcccaaggacagacattgac
gacctcttccataagctgaatggaggcaaggaatacctaacagttgaccagataatcaag
ttcctgaatgagcaacaaagagacccccggctgaatgagatcctgttcccgttctttgac
agaaaaagagttgttgcactcatacaaaagtatgaggtcgacccagagttcacaaaaaaa
gagtggatgagtgtggaggggtttactcggtacctgatgagtgatgagaatgctccagtg
ttcctggacagactggaggagtaccaggacatggaccagcccctgtgccactattacatc
aactcctcccacaacacgtacctgacaggcagacagtttggcgggaagtcatcggtggag
atttacagacaggtgctactggcagggtgcagatgtgtagagctggactgttgggacggt
aagggtgaagaccaggaaccgatcatcactcacggcaaggccatgtgcacagatgtcctc
ttcaaggatgtgatccatgccattgcagagactgcatttgaggcttctgactacccagtg
attctgtcctttgagaaccactgctgcaaagcacagcagtacaagctggcaaagtactgt
gatgaaatctttggtgaccttctgctcaaggaaccactggaagactatgtgctggaagaa
gggaaggatctccctcctcccaatgcactgaagaggaagatcctcatcaagaacaagagg
ctgaagccagagatggaaaaaaagcaactggaactgttctggaagggggagggtaacttg
gaggtggaggaggaagagcactctgagtctgagtgtttcctgctttcaggagaaaacgga
gtcagttcaccatcagaggacgggaacccacaagagttcaagtttaataagtccaacagc
agcagtgacattcaggaagaaggcaaaaatggctccctgaagaacaaaaaggtggagatg
ctggaggaggaacaagccatggccatggcacagtaccagtaccagggggccaccaccaac
gtccacccctggctttcctccatggtcaactacgcacaacctgtcaagttcgccggcttt
gacgtggctgaagatcgcaacatccaccacaacatgtcctctttcaacgaatctgcttgc
cttgggtacctaaagacaagtgccatcgaatttgtcaactataacaagcggcagatgagc
agaatctaccccaagggtgcccgtgtggactccagcaactacatgccgcagatcttctgg
aacgcaggctgccagatggtggctctcaactaccagactccagacttgtccatgcagctg
aaccagggaaagtttgaatacaatggcaagtgcgggtatctgttgaaaccagaattcatg
aggagaccagacaagacttttgatccatttgctgagtcccctgtggatggagttattgct
gctacaattgaagttgaggtgatctcaggtcagttcttgtcagacaagaaagtcggcaca
tacgtggaggtggagatgtacggcctacccaccgacaccatccggaaggagttcaagacc
aagaccattccagccaacggtctgaacccgcagtacaacgaggagccctttgtcttcagg
aaggtggtgctaccggatctcgccacgctgagatttgctgtgtacgatgagaacaacaag
ctgattggccagcgtgtacttccacttgatgggctgcaagcaggctacaggcacgtcggg
ctgcggacggagtccaacttccccatgtcgcttccctgcctcttctgtaacatcaacctc
atgacatatgttccagatggcttaggagagttcgttgatgccctgaacaaccccatgcag
tacctgtcccagctggagaagagagccatggctatgaaggctatgggtattgatgagaaa
gacatagctgacgtccctgccagctcaggcaagaaggataagaaggcagccaatgggaag
tctccagccacgccctcctctagcctgggggttgatgggaaagatgggaaggctaaaaca
ccgacaaaagtttccatagagagccttaagcaggagaagcaatacataaaattaatcaag
aagcaaactaaggagatgaatggtctaaagaagagacatgacaaggaaaaggcagtgatg
cagaaggcccagagcagtgtggtggacaagatggtggcagctcaccagaaggaaaagcaa
agtgtggagaagaatctagaaaaagcaaagaagaagaatgggaccaatgctgctgagctt
gaaagcaaactgaagtccctggtggagaatcatgatgcaaaggtaaaggagatagtggct
actcagaccaaggatttctctgagctggtggccaagtgctctaaggaggagcatgaggtg
aaggagggacacttcaagcagcagtgtgatgtgctgaagcagctgatgaaggtggcacac
gagcagcagaccaaacagatcaccaccatccacgagaagtaa

DBGET integrated database retrieval system