KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_202860Help
Entry
BRAFLDRAFT_202860 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    BRAFLDRAFT_202860
Enzymes [BR:bfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     BRAFLDRAFT_202860
Ubiquitin system [BR:bfo04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    BRAFLDRAFT_202860
Mitochondrial biogenesis [BR:bfo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    BRAFLDRAFT_202860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 358 aa AA seqDB search
LNTERDRLSTYFDWPPDVPVSPEELARQGFFYLGHRDRVECAFCGGVLHQWEAGDDPFIE
HRRHYPHCPFANGEATANIPLGATSPPTGSPGTAQAVVSSPIGTEWPKQPDFADEQSRLS
TFHNWPRYSPMSPLRLVRAGFLYTYVADHVRCYWCDGGLKDWQQDDDPWEEHARWYGSEC
GYVIMNKGMDYIREVRTRRPPVVQQVGLLLKQRLKKNKISYSKPQFRWGVEAGIVQSVLD
MGFDENRVQAVIQNHWQRYNRPFTTATELLNALLPQEESLSFQLTEQPLDPETMERELRR
LREERQCKVCLSADACMVFIPCGHLCCCEHCANMLRMRGRRCPLCRALFQRVQRAFLA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ctaaacacagagagagatcggcttagcacgtactttgactggccaccagacgtccccgtg
tcaccagaagagcttgcaaggcaaggcttcttttatctcggccacagagacagggtagag
tgcgcgttttgtggaggtgttcttcaccagtgggaggcgggtgacgatccattcatagag
catcggcgacactacccacactgccccttcgctaacggagaagcaactgcaaacattcca
cttggagcgacatcgccaccaacgggtagtcctggtacagctcaagcagtcgttagcagc
ccgattgggacggagtggcccaaacaaccagatttcgcggacgagcaaagtcgactgtct
acctttcacaactggccgagatattctcccatgtcacctctgaggctggtacgggcaggc
tttctatacacctatgtagctgaccatgtccgctgttactggtgtgacggtggcctgaag
gactggcagcaggacgatgacccctgggaggagcatgcgcgctggtacgggtctgagtgc
ggctacgtcatcatgaacaagggcatggactacatccgggaagtcaggacacgccgtcct
cccgtcgtgcaacaggttggtctcctcttaaaacaacgacttaagaaaaataaaatatct
tattctaaaccacagtttcggtggggtgtggaagcaggtatcgtacaaagtgttctcgac
atgggattcgatgagaacagagtacaagctgtcattcaaaaccactggcagcggtacaac
agaccatttacaacggcaacagaacttctgaacgcactcctgcctcaagaggagtcatta
tcttttcaacttacagaacaacctctggaccctgagacgatggaaagagagctccggcgg
ctccgtgaggagaggcaatgtaaggtgtgtctgtcagcagacgcctgtatggtgttcatc
ccgtgcggacatctctgctgttgcgaacattgtgccaacatgctgaggatgagaggacgc
cgctgcccgctctgtagagctctcttccagagggttcagcgcgcttttcttgcatga

DBGET integrated database retrieval system