KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_202887Help
Entry
BRAFLDRAFT_202887 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BRAFLDRAFT_202887
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     BRAFLDRAFT_202887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 791 aa AA seqDB search
ARYYNVMWCKVSGRKHKRWEGDAVLVVYKRSVELLDTEGKKIGGASGYKATELSEMTEGQ
TLKVGGKEVEIYDEISLEDWNSGKCFQSIASSSSPDPAPTKVQPKPKPFTNPMKDKQAAT
QRKSAGGSGAPQTVAPRFDPTAEGVLVMPRPSPAHQWKYNPAGQPLVDVVVDPHLSRHLR
PHQRDGIIFLYLCVMGMRDHPGLGAILADSMGLGKTLQCITMIWTLLKQGPYGGKPVLHR
ILIVTPGSLVKNWVKEFKKWLGNERCKVYAVGQDSRVDEFARSPLYPVMIISYEMLVRYV
RDIEKINFDLIVCDEGHRLKNTNIKTTSSISGLSARRRIVLTGTPIQNDLQELHSIVDFC
NPGVLGPITAFRKVYEEPIVRSHQPGATEAEKTLGATRAEELSRLTGQFTLRRTEDVNNK
YLPPKVEAVVFCRPTPLQLDIYRKLLCSRVLKSFLYSNRPTDGSLHLMCISALKKLCNDP
CLIYTAAKEGEDELFGFDQGEESIYKDVLSLFPRGYDPNSSSPEYSGKLQVLADLLGSLY
SEGPRERIVVVSNYTQTLDMVQVRYGYLRLDGSTPTGKRQQIVERFNDKYCRDFVFLLST
KAGGVGLNLIGASRLVLYDIDWNPANDLQAMARVWRDGQPRVVHIYRLITTGTIEEKIYQ
RQISKQGLSGAVVDAKSSSKVQFSAEDLKDLFTLHEDTDSVTHDLLDCAGKTSSCCPGSD
RPQTSAVSRPCQLGQPQSASLLKSNLSMAELLGWTHYRGPLEHQDIQDYHLLSSAENISY
VFVNETNSSQS
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
gctcggtactataatgtcatgtggtgtaaggtgtcagggaggaaacacaagagatgggag
ggtgatgcagtgctggtagtgtacaagagatcggtagaactgttagacacggaagggaag
aagatcggtggagcgagtgggtacaaggcaacagagctgtctgagatgactgagggacag
acactgaaggtgggagggaaggaggtggagatatatgatgagatctcccttgaagactgg
aattctggaaagtgcttccagagtatagcaagctcttcatctcccgaccctgctcctaca
aaggtgcagcctaaacccaagcctttcactaaccccatgaaggacaaacaggctgcaaca
cagagaaaatcagcagggggatccggtgcaccgcaaactgttgcaccaaggtttgaccct
acagctgagggggtgctggtgatgcctcgcccctcccctgctcaccagtggaagtacaac
cctgccggtcagcccctggtggacgttgtagtggaccctcacctgtccagacacctcagg
ccacaccagagagacgggatcatcttcctgtacctgtgtgtcatgggcatgagggaccat
ccaggcctgggtgctatcctggctgactccatgggcctgggtaagactctgcagtgtatc
accatgatatggaccttactgaagcaggggccttacgggggcaagccagtcctgcacagg
attcttattgtcactccaggtagtcttgtcaagaactgggtgaaagaattcaagaaatgg
ctggggaatgagcgctgcaaagtgtatgcagtggggcaggacagcagagttgatgagttt
gcccggtctcccctctaccctgtcatgatcatcagctatgagatgctggtcaggtatgtc
agggatatagagaagatcaactttgacctgatagtgtgcgacgagggccaccggctcaag
aataccaacatcaagaccacttcctctatctcagggctatcagctaggagaagaattgtg
ctaacaggtactcccatccagaatgacctccaggagctccactccattgtagacttctgt
aaccccggggtgttgggaccgatcacggccttcaggaaggtgtatgaggaaccaattgtc
agatcccatcaacccggtgctacagaggcggagaaaacgttgggcgcgacgcgtgcagaa
gaactgtctcgcctcacgggccagttcacgctgcggcggacagaagacgtcaacaacaag
tacctccctcccaaggtggaggctgttgtcttctgcagacccacccccctgcagctggac
atctacaggaagctgctctgttccagggtgctcaagtcctttctttacagcaatagaccc
acagatggaagtttacacctgatgtgtatctcagccctaaaaaagctgtgcaatgatccc
tgcctgatctacactgctgctaaagagggtgaagatgaactctttgggtttgaccagggg
gaagagtccatctacaaggatgtgctatcactctttcccaggggatatgatccaaacagt
tcaagtccagagtattctggtaagctgcaggtcctggctgacctgctagggtccttgtac
tcggaaggacccagagagaggattgtggtggtgtccaactacacacagaccttagacatg
gtacaggtacgttatggttatctgaggctggatgggagcacacctactggcaagagacaa
cagattgtggagagattcaacgacaagtactgcagagactttgtgttcctcctgagtacc
aaggctggtggggtggggctgaacctgatcggagcatctcgcctggtcctgtacgacatt
gactggaaccctgctaacgacctgcaggccatggcacgtgtgtggcgggacggccagccc
agggtcgtacacatctacaggctcatcactaccggaaccatagaggagaagatctaccag
cgacagatcagtaaacagggtctgagtggggcggtggtggacgccaagagctccagtaag
gtgcagttctcagcagaggacctgaaggatctcttcactctacatgaggacacagacagt
gtcacacatgacctgttggactgtgctggtaagacatcatcatgctgccctggctcagac
cgaccccagaccagcgcggtgtcgcgcccctgtcagctgggccagccccagtctgccagc
ctgctgaagtctaacctgtccatggcagagctgctggggtggacacactacagggggccg
ctggagcaccaggacatccaggactaccatctgttgtcttcagcagagaacatcagctat
gtctttgtcaatgaaactaacagttcacaatcttaa

DBGET integrated database retrieval system