KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_203045Help
Entry
BRAFLDRAFT_203045 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    BRAFLDRAFT_203045
Enzymes [BR:bfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     BRAFLDRAFT_203045
Ubiquitin system [BR:bfo04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    BRAFLDRAFT_203045
Mitochondrial biogenesis [BR:bfo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    BRAFLDRAFT_203045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 7214452
NCBI-ProteinID: XP_002596205
JGI: 203045
UniProt: C3Z5V4
AA seq 371 aa AA seqDB search
LNTELHRLHTYYGYGWPMDTPVSPEQLAKLGFFYLGVRDKVECAFCGGVLHQWEQGDDPK
VEHERHYSHCPFIRGYATANVPLESTRQPTTRYSHETEKRPQTENKKGPKRPDLSSEELR
VSTFLRWPLYSPIAPRKLAQAGFYYTYMDDQVRCFWCDGGLKDWQAGDDPWTEHARWYGE
ECDFVLRQKTLSFIQETFNQAFVSSGAVTIGSQQAGVQNPQTETPYHAMFQEAMDSRLIQ
SALEMGFERQQVENIVHKQLRRHGRPFAKMTDIVEALLAHGEGQNGSEDEDKKNAAEAKT
QTTQESPPRQLQQLLEERTCKICMDESACMVLIPCGHMCCCENCVQMLRARGGRCPMCRA
RIQRVQKTFIA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ctgaataccgaactccaccgcttacacacgtactacgggtacggatggccgatggacacg
cccgtatctccagaacagttggcaaaactgggcttcttctatcttggtgtacgagataaa
gtagagtgtgcgttttgtggcggggttctacaccagtgggagcaaggagatgatcccaaa
gtcgaacacgaacgacattactcccactgtcctttcattcgggggtacgcaaccgcaaac
gtcccgctagaatctaccagacagcctactactcgctactcacatgagacagaaaaacga
cctcaaacagagaataaaaagggcccaaaacgccccgatctgtcgtccgaagaactgcga
gtctccacgttcttgagatggccgctgtacagtcctattgcaccgcggaaactggcacag
gctgggttctattacacatatatggatgaccaggtgaggtgtttttggtgcgatggcggc
ctgaaggactggcaggcgggggatgacccatggacggagcatgcgcgctggtacggggaa
gagtgtgactttgttctgcgccagaaaaccctcagctttatccaagaaacgttcaaccaa
gccttcgtgtccagtggcgcagtcaccattgggtctcaacaggccggcgtacagaaccca
cagacggagacaccgtaccacgccatgtttcaggaagccatggactcacgtctgatccag
agcgctctcgagatgggcttcgagcgtcaacaggtggaaaacatcgtccataagcaactg
aggaggcacgggagaccgttcgcgaagatgacagacattgtagaggctctcctagctcac
ggggagggtcagaatggctccgaggatgaggacaagaagaacgcggctgaggcaaagact
caaaccacacaggagagtccacctcggcagctgcagcagctgcttgaggagcgcacgtgt
aagatctgcatggacgagagcgcgtgcatggtgctcatcccgtgcggacacatgtgctgc
tgtgagaactgcgtgcagatgctgcgcgcgcgcggagggaggtgccccatgtgccgggcc
cgcatccagcgcgtccagaagacgttcatcgcctga

DBGET integrated database retrieval system