KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_203130Help
Entry
BRAFLDRAFT_203130 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    BRAFLDRAFT_203130
Mitochondrial biogenesis [BR:bfo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    BRAFLDRAFT_203130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 376 aa AA seqDB search
LNTELHRVHTFFGWPEGTPVRPERLAKLGFFYLGVRDKVECAFCGGVLHQWEEGDDPKTE
HQRHYPHCPFIRNCATSNVPLDNPATPNVPQDSPDSCTEQQRGHIESEPPPPPGGTDHPK
HPELSSEEDRLSTFFRWPLYSPISPRKLAQAGFYYTYIDDQVKCYWCEGGLKDWQAGDDP
WTEHARWYGEECGFVLRERGIGYVRQIKNTFPSLVQVIGAANVTVQVGEGDPEDEFEERV
LDAMDSRVVRNVVEMGFGQQNVEIVVRRRLRARRGPFTTMTDLVEALLAMDDNEEPAEDP
YTEDEEDRNAELQRRLQRMKEERMCKICMTNDATMVFIPCGHLCCCEGCAHTMRSRGRKC
PICRARILKVQRAFLA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacagagcttcatagagtccacactttctttggctggccagaaggaacaccagtt
cgcccagaacggttggcaaagcttggtttcttctatctcggggtccgagacaaagttgag
tgcgcattctgtggaggtgttctccaccaatgggaggagggggacgatccaaagacggaa
catcagcgacattacccacactgtcccttcatacggaactgtgcaacctctaacgttcca
ctggacaaccctgcaacccctaatgttccccaagacagccctgacagctgtacagagcaa
cagcgtgggcacatagagagtgaaccacctccaccgcctggtggaaccgaccatcccaaa
catccagagctgtcatcagaagaagaccgactgtcaacattcttccgctggccactttac
agtcctatatcaccacgcaagcttgcacaggctgggttttattatacatatattgatgac
caagtcaagtgctactggtgtgagggaggcctgaaggactggcaggcaggggacgaccct
tggacagaacatgcgcgctggtacggggaggagtgtggctttgtgctacgagaacgaggc
attggctatgtccgtcagataaagaacacctttccttcactcgtacaggtaataggtgct
gcaaatgtcacagtccaagtaggggagggggacccggaagatgagtttgaggaacgcgtc
ttagatgccatggactctagagtagtaaggaacgttgtagaaatgggcttcggccagcag
aacgtagagattgtcgtacgcaggaggctccgtgcacgtagaggacctttcacaaccatg
acagaccttgttgaagcattgctagcaatggatgacaacgaagaaccagcagaagatccc
tacacagaagatgaggaggacagaaatgcggaacttcaacggaggcttcaacgaatgaaa
gaagagcgcatgtgtaaaatttgcatgactaatgatgccaccatggtgttcattccatgt
ggccacctgtgctgttgtgagggctgtgctcacactatgagatcaagagggagaaagtgc
ccaatatgcagagcacgcatcctgaaagtccagcgtgctttcctcgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system