KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_203631Help
Entry
BRAFLDRAFT_203631 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     BRAFLDRAFT_203631
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   BRAFLDRAFT_203631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 468 aa AA seqDB search
MQALQSRIPLTFRDPAGAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQVQGDDTSHKKER
KVYNDGYDDDNYDYIVRIGEKWEDRYEIDSLIGKGSFGQVVKAYDHGDQEYVAIKIIKNK
KAFLNQAQIEVRLLELMNKHDPEGKCYIVKLKRHFMFRNHLCLVFELLSYNLYDLLRNTN
FRGVSLNLTRKFAQQMCTALLFLSTPELSIIHCDLKPENIVLCNPKRSAIKIVDFGSSCQ
LGQRIYQYIQSRFYRSPEVLLGIPYDMAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKI
VEVLGIPPAHCLDQAPKARKYFDKHPDGTYSIRKSKDGKKYKPAGSRKLHDILGAETGGP
GGRRMGEAGHSVADYLKFKDLILRMLDFDPKTRITPFHALQHNFFKRTADESTNTSNSVS
TSPAMEQSSGAGSSASSSGILFSFFGGTTSGARARSDPTHQHGHHSHH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcactgcagagtcggatcccgctaacgtttcgcgacccggccggtgccccgctc
cgcaagctcagcgtggacctgatcaagacgtataaacatatcaacgaggtttactatgca
aagaaaaaacggcgggctcagcaagtccaaggtgacgacacaagccataagaaggagagg
aaagtgtacaatgatgggtacgacgatgacaactacgattacatcgtgaggataggagag
aagtgggaggacagatacgagattgactcacttatagggaaaggatcatttggccaggtg
gtgaaggcatacgatcacggtgaccaggagtatgttgccataaaaataatcaagaacaag
aaagcatttctgaatcaagcacagatcgaagtacggttgttagaacttatgaacaagcat
gacccagaaggaaagtgttacattgtcaaactgaagcggcacttcatgttccgcaaccac
ctctgcctggtcttcgagttgctgtcctacaacctgtacgacctgctgcggaacaccaac
ttccggggcgtgtcgctcaacctgacgcggaagttcgctcagcagatgtgcacggccctg
ctgttcctgtccacgccagagctcagcatcatccactgtgacctgaagccagagaacatt
gtcctgtgcaatcccaagagaagtgcaattaagattgtggactttgggagctcatgtcaa
ttgggacaaaggatataccagtatatccagagcaggttctacaggtcaccagaggtgctg
ctggggatcccttacgacatggccatcgacatgtggagtctgggctgcatcctggtggag
atgcacacaggggaacccctcttcagcggctctaacgaggttgatcagatgaacaagatt
gtggaagtgctgggcattcctcccgctcactgcctagaccaggcacccaaggcacgcaag
tattttgacaagcaccccgacgggacgtacagcattaggaaaagcaaggatgggaaaaag
tacaagccagcgggcagtagaaaactgcacgacatcctgggcgcggagacgggcggcccc
ggagggcggcggatgggcgaagccggccacagtgttgcagactatctcaagttcaaagac
ttgatattgcgaatgttggactttgaccccaagacgaggataacaccgttccatgcgtta
caacacaacttcttcaagcggacggcggatgagagtacgaataccagtaatagtgtatca
accagccccgcaatggagcaaagctcaggtgcagggtcatcggcatcgagttctggtatt
ttattttcattctttggaggaactacgtcgggcgctcgcgctcgctcggatcccacgcac
cagcacggtcatcattcgcaccac

DBGET integrated database retrieval system