KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_206818Help
Entry
BRAFLDRAFT_206818 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 7224676
NCBI-ProteinID: XP_002593425
JGI: 206818
UniProt: C3ZD81
AA seq 243 aa AA seqDB search
GAAPFDSLQVADIGDVFINMYDLKDAVKKIREAYSKIVANGCKPLTLGGDHTLTYPILQA
IKTKYGPVGLVHVDAHADTSDKQLGEKISHGTPFRRAVEEGLLDCQRVLQIGLRGTGYSS
DDYGWSRQQGFRVVQAEEIWYKSLAPLMEEVRAQMGDGPVYLSFDIDALDPAYAPGTGTP
EIGGLTSHQGLEIIRGCRGLNLVGGDLVEVSPAYDPSGNTALTAANLLFEMLCVLPGVQY
RRG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
ggtgctgcaccatttgactccctccaagttgcagatatcggagacgtctttatcaacatg
tatgacttgaaggatgctgtgaagaagatccgagaggcctactctaagatcgtggccaat
gggtgcaagcctcttactctggggggtgaccacactctaacctatcccatcttacaagca
atcaagacgaagtatggtcctgttggcttagttcatgttgatgcccacgctgacaccagc
gacaagcagctcggagaaaagatctcccacgggacgcccttccgcagggcggtggaggag
ggcctcctagactgccaacgagttttacagatagggctgagaggcacggggtattccagt
gatgattatgggtggagcaggcaacagggtttccgagtggtccaggcagaagagatctgg
tacaagtctctggcaccactgatggaggaggtacgtgcacagatgggggatggtccggtc
tatctgagctttgacatcgatgccctggacccggcgtacgcgccagggacgggaaccccg
gagatagggggactgacgtcgcatcagggcttagaaatcatcaggggatgtcgtgggctc
aacttggtgggaggggacttggttgaggtctctccagcctatgacccatccggtaacacc
gccctgactgcagcgaacctgttgtttgagatgctgtgtgtcttgcctggggtgcagtac
agacgtggctga

DBGET integrated database retrieval system