KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_206818Help
Entry
BRAFLDRAFT_206818 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BRAFLDRAFT_206818
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BRAFLDRAFT_206818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 243 aa AA seqDB search
GAAPFDSLQVADIGDVFINMYDLKDAVKKIREAYSKIVANGCKPLTLGGDHTLTYPILQA
IKTKYGPVGLVHVDAHADTSDKQLGEKISHGTPFRRAVEEGLLDCQRVLQIGLRGTGYSS
DDYGWSRQQGFRVVQAEEIWYKSLAPLMEEVRAQMGDGPVYLSFDIDALDPAYAPGTGTP
EIGGLTSHQGLEIIRGCRGLNLVGGDLVEVSPAYDPSGNTALTAANLLFEMLCVLPGVQY
RRG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
ggtgctgcaccatttgactccctccaagttgcagatatcggagacgtctttatcaacatg
tatgacttgaaggatgctgtgaagaagatccgagaggcctactctaagatcgtggccaat
gggtgcaagcctcttactctggggggtgaccacactctaacctatcccatcttacaagca
atcaagacgaagtatggtcctgttggcttagttcatgttgatgcccacgctgacaccagc
gacaagcagctcggagaaaagatctcccacgggacgcccttccgcagggcggtggaggag
ggcctcctagactgccaacgagttttacagatagggctgagaggcacggggtattccagt
gatgattatgggtggagcaggcaacagggtttccgagtggtccaggcagaagagatctgg
tacaagtctctggcaccactgatggaggaggtacgtgcacagatgggggatggtccggtc
tatctgagctttgacatcgatgccctggacccggcgtacgcgccagggacgggaaccccg
gagatagggggactgacgtcgcatcagggcttagaaatcatcaggggatgtcgtgggctc
aacttggtgggaggggacttggttgaggtctctccagcctatgacccatccggtaacacc
gccctgactgcagcgaacctgttgtttgagatgctgtgtgtcttgcctggggtgcagtac
agacgtggctga

DBGET integrated database retrieval system