KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_207882Help
Entry
BRAFLDRAFT_207882 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 495 aa AA seqDB search
MFLIFQMLVPFSLPAKKNKMAHILTVEDHKEFKKILRTRTNVLSLFAKSERAASPILDTF
AQVAEDMKGLGTLVFVDCSDKEAKKLCKKVKSNPDTYELKHYKDGDFNKGYDRQETYKSM
MNFLRDPTGDIPWEEDPTAKDVVHVESDKALNKLVKKEKTPILMMFYAPWCGHCKRLKPD
YAAAATELKGQAVSTTLAGMDVDKPENEPVRRQFNITGFPTILYFEGGKQKYKYGGENNK
QGIVSWMKDPQPPVEKPPEPEWSDVESDVVHLTDETFDTYMEEHASVLVMFYAPWCGHCK
KMKPEYDEAATTLKEESIDGVLAAVDATKSPQVAKRFEVKGYPTVKYFKDGEEAFGFNDR
TADKIVDFMKDPKEPPPPPPPEQPWQDVESEVVHLGDEDFKSQLKRRKHALVMFYAPWCG
HCKKAKPHFTNAAEKYKEDTKVTFAAVDCTTHQGVCGQYEVRGYPTIKYFNYGKNPKDYE
GGREEADFVAFMSDP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgatcttccagatgctggtaccgttctccctgcccgccaagaagaacaagatg
gcccacatcctgactgtcgaggatcataaggagtttaagaagattctcaggaccaggacc
aacgtcttgtctctgtttgccaagtcagagagggcagccagtcccatactggacaccttt
gcgcaggtagcagaagacatgaagggacttggtaccctcgtctttgtggactgcagcgac
aaagaagcgaagaaactgtgcaagaaggtgaaatctaacccagacacctacgagctcaaa
cattacaaggatggtgacttcaacaaaggttatgacagacaagaaacttacaagtcgatg
atgaacttcctgcgtgacccgacgggcgacattccttgggaggaggaccccaccgcgaag
gatgttgtacacgtggaaagcgataaggccttgaacaaacttgtgaaaaaagaaaagact
ccgatcctgatgatgttttatgcaccatggtgtggccactgtaagaggttgaaaccagac
tatgctgcagcagctactgaactgaaaggacaagctgtgagtaccacactagcaggaatg
gatgtggataaaccagagaatgaacctgtcaggagacagtttaacatcacagggttccct
actatactgtacttcgagggtggaaagcagaagtacaagtatggaggagaaaacaacaaa
cagggcatagttagctggatgaaggatccccagcctccagtagagaagccccctgagcca
gagtggagtgatgtggagtcagacgtggtccatctcaccgacgagacattcgacacctac
atggaggagcacgcctctgtactcgtcatgttctacgcaccatggtgtggtcactgcaag
aagatgaagccagaatatgacgaggcagcgaccaccctcaaggaggaaagtattgatggc
gttttggcggctgtggacgcaaccaagtcacctcaggtcgctaaaaggtttgaggtcaaa
ggttacccaacggtcaagtatttcaaggacggagaggaggctttcgggttcaacgacagg
acggcggataaaatagtggacttcatgaaggatccgaaggagccgccccctccccctccc
cccgagcagccttggcaggatgtggagagtgaggtcgttcacctcggggacgaggacttt
aagtctcagctgaagaggaggaaacatgccctggtcatgttttacgctccatggtgtggt
cactgcaagaaggccaagccacatttcaccaatgctgcagagaaatacaaggaggacacc
aaggtgacgtttgcagcggtggactgtaccactcaccaaggggtgtgcgggcagtacgag
gtcagaggttaccccaccatcaagtacttcaactacggcaagaaccccaaggactacgag
ggcggtcgggaggaggcagactttgtcgccttcatgtcggacccc

DBGET integrated database retrieval system