KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_210236Help
Entry
BRAFLDRAFT_210236 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BRAFLDRAFT_210236
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     BRAFLDRAFT_210236
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   BRAFLDRAFT_210236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 325 aa AA seqDB search
MDRANINICFISQDKKTPLTGFTINDVVRSGLLVPSSDIGVYAGDEECYHLYRHFYDPVI
KECHGVSEIPVHVSNLDPHRLTSAIKNEAAILSTRCRVVRNLAGYGFPAGISRENRLEVE
GILVTALEDLEGDLNGQYHPYDTLTGSEKQNMMMSGYLFRESDEFQVGAGMARDWPEGRG
IFYNHDKTFLAWVHEEDHLRIISMQKGANFKQVFDRLCRGINAINKALLKHAQTEFACHK
QYGYLSSCPTNLGTGMRASVHMHIPNTLTESQFKNRCCKLGLDVRGRHGEKCDSDGGVYD
VSNLQRLGSTEVEQVQTLVDGINSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggatagggctaacattaatatttgttttatttctcaggacaaaaagacgccattgacc
ggtttcaccattaacgatgtggtacggagtggacttctagttcccagtagtgacattgga
gtctatgcaggagacgaggagtgttatcatctgtatcgtcacttttacgacccagtcata
aaagagtgccatggagtcagtgagatacctgtccacgtctccaacctggatcctcaccgt
ttgacgtctgcgataaagaacgaagcggcgattctgtcaactaggtgtagggtggtcagg
aacctggctggatatggattccctgccggaatttcccgtgaaaaccgtctagaagttgag
ggaatcttggtgactgcacttgaggaccttgagggagacctcaacggacaatatcaccca
tacgatacattaacaggctcggaaaaacaaaatatgatgatgagtggatatcttttccgg
gagagtgatgagttccaggttggtgcagggatggctcgagattggccggagggtcgtggc
atattttacaaccatgacaaaacatttttggcgtgggttcacgaggaggaccatcttagg
atcatttccatgcagaaaggagcaaacttcaagcaagtgtttgatcgtctttgtcgaggc
atcaacgccatcaacaaggccctactgaagcatgcgcagactgagttcgcgtgtcacaag
cagtatggctacctgtcgagctgccctacaaacctaggcacgggcatgcgcgctagcgtc
cacatgcacatccccaacacgctaacggagtcccaattcaagaacaggtgttgtaagctt
gggttggacgttagaggccgacatggagaaaaatgtgatagtgacggaggtgtgtatgac
gtatccaaccttcagcggctgggtagtaccgaagtggagcaggtacaaacactggttgat
ggcatcaactccatttga

DBGET integrated database retrieval system