KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_210236Help
Entry
BRAFLDRAFT_210236 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00330  Arginine and proline metabolism
bfo01100  Metabolic pathways
Module
bfo_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BRAFLDRAFT_210236
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     BRAFLDRAFT_210236
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   BRAFLDRAFT_210236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 7235314
NCBI-ProteinID: XP_002602667
JGI: 210236
UniProt: C3YM85
AA seq 325 aa AA seqDB search
MDRANINICFISQDKKTPLTGFTINDVVRSGLLVPSSDIGVYAGDEECYHLYRHFYDPVI
KECHGVSEIPVHVSNLDPHRLTSAIKNEAAILSTRCRVVRNLAGYGFPAGISRENRLEVE
GILVTALEDLEGDLNGQYHPYDTLTGSEKQNMMMSGYLFRESDEFQVGAGMARDWPEGRG
IFYNHDKTFLAWVHEEDHLRIISMQKGANFKQVFDRLCRGINAINKALLKHAQTEFACHK
QYGYLSSCPTNLGTGMRASVHMHIPNTLTESQFKNRCCKLGLDVRGRHGEKCDSDGGVYD
VSNLQRLGSTEVEQVQTLVDGINSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggatagggctaacattaatatttgttttatttctcaggacaaaaagacgccattgacc
ggtttcaccattaacgatgtggtacggagtggacttctagttcccagtagtgacattgga
gtctatgcaggagacgaggagtgttatcatctgtatcgtcacttttacgacccagtcata
aaagagtgccatggagtcagtgagatacctgtccacgtctccaacctggatcctcaccgt
ttgacgtctgcgataaagaacgaagcggcgattctgtcaactaggtgtagggtggtcagg
aacctggctggatatggattccctgccggaatttcccgtgaaaaccgtctagaagttgag
ggaatcttggtgactgcacttgaggaccttgagggagacctcaacggacaatatcaccca
tacgatacattaacaggctcggaaaaacaaaatatgatgatgagtggatatcttttccgg
gagagtgatgagttccaggttggtgcagggatggctcgagattggccggagggtcgtggc
atattttacaaccatgacaaaacatttttggcgtgggttcacgaggaggaccatcttagg
atcatttccatgcagaaaggagcaaacttcaagcaagtgtttgatcgtctttgtcgaggc
atcaacgccatcaacaaggccctactgaagcatgcgcagactgagttcgcgtgtcacaag
cagtatggctacctgtcgagctgccctacaaacctaggcacgggcatgcgcgctagcgtc
cacatgcacatccccaacacgctaacggagtcccaattcaagaacaggtgttgtaagctt
gggttggacgttagaggccgacatggagaaaaatgtgatagtgacggaggtgtgtatgac
gtatccaaccttcagcggctgggtagtaccgaagtggagcaggtacaaacactggttgat
ggcatcaactccatttga

DBGET integrated database retrieval system