KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_210676Help
Entry
BRAFLDRAFT_210676 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BRAFLDRAFT_210676
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BRAFLDRAFT_210676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 259 aa AA seqDB search
MQKCSFSFVNKVGEDVFGGNFIQNFKDNGVNVDHVQETKEASTGVAPIAVNQDGQNSIII
VSGANLKLTAADVREHESVITHAKVLICQLEVQPETSLEALRIAKQHGVTTILNPAPAEA
TLDPELYKLSDVFCPNETEAEILTGLPVTTVEEAEKAADILLHKGCKKVIITLGEKGCLC
KSSMSEKGIHVPARKVSPVDTTGAGDAFVGSLAYYMACHKDLRLEEAIQNACHISSISVC
SPGTQTSFPYRKDLPQELL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatgttctttttctttcgttaacaaggtgggagaggatgtctttggaggcaac
ttcattcaaaacttcaaagacaatggagtcaatgtcgatcatgttcaagagacaaaagaa
gcatccacaggcgtggcccccattgctgtcaatcaagatggtcagaattccataatcata
gtgagtggagccaacctgaagttgactgcagctgatgtgagggagcatgaatcagtcata
actcatgcaaaagttctcatctgtcaactagaggtgcaaccagaaacttcactggaggcc
ctgaggatagcaaaacagcatggagtgactaccatcctgaaccctgctccagcagaagct
accctggatccagaactctacaagttatctgatgtcttctgtccaaatgagactgaggca
gagatactgacaggactgcctgtcacaacagtagaagaggcagaaaaagctgcagatatc
ctgctgcataaagggtgtaagaaagtcatcatcacactaggtgagaagggctgcctctgt
aagtcttccatgtcagagaaaggcatccatgttccagccaggaaggttagcccagtggac
accacaggtgcaggagatgcctttgtgggcagccttgcctactacatggcctgccacaaa
gacctgaggttggaggaggcaatacagaatgcttgtcacatctcctccatcagtgtgtgc
agcccggggacccagacaagcttcccatacaggaaggaccttccacaggaacttttataa

DBGET integrated database retrieval system