KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_212503Help
Entry
BRAFLDRAFT_212503 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 195 aa AA seqDB search
KQQYLKGVKTAVSSSAQRFSGYLQHDAHEFLSQCLDQLKEDIKKVRSAEAKKSGDDKEVW
TCSDDCGLPCPVSQNFQFEVIHTIRCTNCEDVVIKKEKFHDLSLTLPRKRKDMNPRSLQD
LLDHFFLAEDIEYACGQCKSKKSRVSHQFTKLPRVLILHLKRYNYNHVMSVNRKMEQPVF
LPLYLTLQSHCTEDT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
aagcagcagtatctgaagggggtgaagacagcagtgtcatcgtccgcacagaggttctct
ggctacttacaacatgatgcccatgagttcctgagccagtgtctggaccaactcaaggag
gacatcaaaaaggttcgatcagccgaggccaagaagagtggcgatgacaaggaggtatgg
acatgttcagacgactgtggcctgccgtgtcctgtgagtcagaacttccagtttgaagtg
atccacaccatcaggtgtaccaactgtgaggatgttgtcatcaaaaaggagaagtttcac
gacttgtccctgaccctgcccaggaaaaggaaagacatgaatcccagatcactgcaggat
ctgttggaccatttcttcttggctgaagacattgagtacgcatgtgggcagtgtaagagt
aagaagagcagagtgtcgcaccagttcaccaaactaccaagggtactgattctccatctg
aagaggtacaactacaaccatgtgatgtcagtgaaccggaagatggaacagccggtgttc
ctccccctgtacctgaccctgcagagtcactgcacggaggacact

DBGET integrated database retrieval system