KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_213230Help
Entry
BRAFLDRAFT_213230 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 578 aa AA seqDB search
SSQVTFEFSDANGRPAGQAELSLTAYFLSLDVDCDRDGVVEVNNPHKGTWEWGPRGHGAV
LLVNNDNDDFEGTFDPDNKNSRIDGPLDIKDMSPMVVRMRGPPKLPAEYSIRLSTPPECA
ERMGVFCLQPDGEDLFRYFGHVGNVVELDYRVDLRDNTATYEFAVEGLHYPDTMFDGQVS
ITLTLQRVSSPIYEDTVVFQVAPWIMTPNTLPPLEAFVCEMEGGENLSFIQELQEVTSAA
GVPLVIVPQVVNRGDRWMQDEIELGYSQVPGKDVMPVVLDSPRDRGLQHFPKIQLLGKDF
GYVTRFSRTEEPNSLDSFGNLEVSPPVTANGKKYPLGRILIGSTSPTNQYGRRMMKVVRS
FLKAQRVQSPVELYSDWLAVGHIDEFMTFIPARGGKGFRLLLASPDACYAYLGWLQSQGH
GNVPLFEGTSFQSIDSSAVTVDQLLQDSKLREENQVFQDDIDWNRDKLKRELGLTEGDII
DIPALFKDEEGKGAGSFFPDMVNMIVLGRHLGIPKPFGPIVDGACALESYVKSLLQPLGL
SCNFIDDWSSYHLMMGEVHCGTNTLRKPFNYKWWHVEP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
tcctctcaggtgacctttgaattcagcgacgcgaacggccgtccagcggggcaggcagag
ctgagtctgacggcgtacttcctgtctctggacgtggactgtgacagagacggggtggtg
gaggtcaacaatccccacaagggtacgtgggagtggggtcccagagggcacggggctgtg
ctcctggtcaacaacgacaacgatgacttcgaagggacctttgacccggataataaaaac
agcaggattgatggaccactagatataaaagacatgagcccgatggttgtgcgcatgcgt
gggccaccaaagctgcccgcggagtactctataagactgagcacaccgccagagtgcgcc
gagagaatgggggtcttctgtctacagcctgacggtgaggatttattcagatattttggt
catgtcggtaatgtggtggagttagactatcgagtggacttgcgagacaacaccgctacg
tacgagttcgccgtggaggggctacattatccggacaccatgtttgatgggcaggtgtcc
atcactctaacactgcaaagggtgagctcaccaatttatgaagacacagtcgttttccaa
gtcgcaccgtggattatgacacccaacacactccctcctttagaggcgttcgtgtgtgaa
atggaaggtggggaaaacctgagcttcatccaagagctacaggaagtgacgtcagcagcc
ggcgtgccgttagtcatcgtgccgcaggtcgtcaacaggggggacaggtggatgcaggat
gaaatcgagctcggttactcgcaggtaccagggaaggacgtcatgcccgtggtactggac
tcccctcgtgaccgaggtcttcaacacttccccaagattcagcttctcggaaaagacttc
ggctacgtgacccgtttcagccggacagaggaacctaactccctggactccttcggtaac
ctggaagtcagtccgcctgtgacagcaaacggcaagaaatatccgcttgggcgcattctg
attggatctacctcccctacaaaccagtatggacgacggatgatgaaagttgttcggagt
ttcctgaaggcacagagagtccagtcacctgtggagctctactctgattggctggcagtc
ggccatattgatgagttcatgacgtttatcccggcaaggggaggaaagggtttccggctc
ctgctggccagcccagatgcctgctacgcgtatttaggatggctgcagagtcaaggacac
gggaacgtcccactcttcgagggtaccagctttcagtctattgattcatctgctgtaacg
gtagatcaactattgcaggacagcaagttaagggaggagaaccaagtattccaggatgac
atcgactggaatcgtgacaagctgaaacgggagctgggtttgacagaaggagacatcatc
gacattccagcactgttcaaggatgaggaaggcaagggggcagggtcgttctttcccgac
atggtcaacatgattgtgcttggccgccatcttggaatcccgaaaccctttgggcccatc
gttgacggcgcatgcgcattagaatcgtacgtgaagtcgcttctgcaaccgctggggctc
agttgtaacttcatcgatgattggagctcctatcatctcatgatgggcgaggtgcattgt
gggacaaatacactgagaaagcccttcaactataaatggtggcatgttgagccttag

DBGET integrated database retrieval system