KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_213306Help
Entry
BRAFLDRAFT_213306 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    BRAFLDRAFT_213306
G protein-coupled receptors [BR:bfo04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    BRAFLDRAFT_213306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 406 aa AA seqDB search
YSIPAKVAIGLSASSVMVMIIVGNILVCIAVVTERKLRHPQNWFLVSLAASDLLVWTLIM
PFALAYELMGYWAFGPVWCEIWLAMDVFACTASIFNLCLIALERYRCVVNPTAYSSPTIN
RRQGILIAGAYITAAAISLPPLFGWAEPRAQDGALPECPLHQSLGYVAFSATASFYIPLI
VMVTAYICLIVATRAHLRKKLTNCPPATPIASRSRTPMTTPKIRKEKKDGHVTNDVNHLK
PPTSIRLQLKTAAQQLNVAPRCAIETEDSSLQAQAQSTDCIKVLQRVGTRLEMQFDRNRK
DEPSPGGERLKILQSRERRFTLIIGLVMGAFIVCWYPFFQLYPIVIACESCKVPEVVFKF
FFWIGYCNSAANPIIYTIFNKDFRGAFLRIITCGVRNNRTHGANGR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
tacagtattcccgccaaggtggccatcggactctcggcatcatcggttatggtcatgatc
attgtgggaaacatactggtatgcatagctgtcgtcacggagcggaagttacgtcatccc
cagaactggttcctggtgtcattggccgctagtgacctactggtatggacgctcatcatg
ccgttcgcgttggcatatgagctgatgggttactgggcgttcgggccggtgtggtgtgag
atctggctggccatggacgtgttcgcctgtaccgcctctatcttcaacctgtgtctcatc
gcgctggagcggtaccgctgcgtcgtcaacccgacagcatacagcagcccaacgatcaac
cggcgccaggggatcctgatcgcaggagcttacatcaccgccgctgccatctccctcccg
ccgctgttcggctgggccgagccccgggcgcaggatggcgccctcccggagtgcccacta
caccagtcccttggctacgtcgccttctcggccactgcgagcttctacatccctctcata
gtcatggtgacggcctacatctgtctgatcgtggcaacccgagcgcacctccgaaagaag
ctgaccaactgtcctccggcaactcctatagcgtctcgttcaagaacgcccatgacaacc
ccaaagataaggaaggagaagaaagatggccatgttacaaacgacgtgaaccatcttaaa
ccaccgacgagtatccgtttgcagttgaagacggcggcacaacagctcaacgtagcgccc
aggtgtgctatcgagacggaagacagctctctccaagcgcaagcacagagcaccgactgc
atcaaagttctgcagcgagtcggcaccaggttggagatgcagttcgacaggaatcgcaag
gacgagcccagtcctggtggggagaggctgaagattttacagtctcgggagcggcggttc
acgctgatcatcgggctcgtcatgggggcgttcattgtgtgctggtacccgttcttccag
ctctatcccatcgttatcgcctgtgagtcgtgcaaggtgcctgaagttgtcttcaagttc
ttcttctggatcggatactgcaacagcgccgccaacccgatcatctatactatatttaac
aaggacttcaggggcgcctttctgagaatcatcacttgcggcgtccgcaacaatcgtacg
catggcgccaacggtagatga

DBGET integrated database retrieval system