KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_213306Help
Entry
BRAFLDRAFT_213306 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 7234663
NCBI-ProteinID: XP_002612995
JGI: 213306
UniProt: C3XST3
AA seq 406 aa AA seqDB search
YSIPAKVAIGLSASSVMVMIIVGNILVCIAVVTERKLRHPQNWFLVSLAASDLLVWTLIM
PFALAYELMGYWAFGPVWCEIWLAMDVFACTASIFNLCLIALERYRCVVNPTAYSSPTIN
RRQGILIAGAYITAAAISLPPLFGWAEPRAQDGALPECPLHQSLGYVAFSATASFYIPLI
VMVTAYICLIVATRAHLRKKLTNCPPATPIASRSRTPMTTPKIRKEKKDGHVTNDVNHLK
PPTSIRLQLKTAAQQLNVAPRCAIETEDSSLQAQAQSTDCIKVLQRVGTRLEMQFDRNRK
DEPSPGGERLKILQSRERRFTLIIGLVMGAFIVCWYPFFQLYPIVIACESCKVPEVVFKF
FFWIGYCNSAANPIIYTIFNKDFRGAFLRIITCGVRNNRTHGANGR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
tacagtattcccgccaaggtggccatcggactctcggcatcatcggttatggtcatgatc
attgtgggaaacatactggtatgcatagctgtcgtcacggagcggaagttacgtcatccc
cagaactggttcctggtgtcattggccgctagtgacctactggtatggacgctcatcatg
ccgttcgcgttggcatatgagctgatgggttactgggcgttcgggccggtgtggtgtgag
atctggctggccatggacgtgttcgcctgtaccgcctctatcttcaacctgtgtctcatc
gcgctggagcggtaccgctgcgtcgtcaacccgacagcatacagcagcccaacgatcaac
cggcgccaggggatcctgatcgcaggagcttacatcaccgccgctgccatctccctcccg
ccgctgttcggctgggccgagccccgggcgcaggatggcgccctcccggagtgcccacta
caccagtcccttggctacgtcgccttctcggccactgcgagcttctacatccctctcata
gtcatggtgacggcctacatctgtctgatcgtggcaacccgagcgcacctccgaaagaag
ctgaccaactgtcctccggcaactcctatagcgtctcgttcaagaacgcccatgacaacc
ccaaagataaggaaggagaagaaagatggccatgttacaaacgacgtgaaccatcttaaa
ccaccgacgagtatccgtttgcagttgaagacggcggcacaacagctcaacgtagcgccc
aggtgtgctatcgagacggaagacagctctctccaagcgcaagcacagagcaccgactgc
atcaaagttctgcagcgagtcggcaccaggttggagatgcagttcgacaggaatcgcaag
gacgagcccagtcctggtggggagaggctgaagattttacagtctcgggagcggcggttc
acgctgatcatcgggctcgtcatgggggcgttcattgtgtgctggtacccgttcttccag
ctctatcccatcgttatcgcctgtgagtcgtgcaaggtgcctgaagttgtcttcaagttc
ttcttctggatcggatactgcaacagcgccgccaacccgatcatctatactatatttaac
aaggacttcaggggcgcctttctgagaatcatcacttgcggcgtccgcaacaatcgtacg
catggcgccaacggtagatga

DBGET integrated database retrieval system