KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_213409Help
Entry
BRAFLDRAFT_213409 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
bfo04144  Endocytosis
bfo04350  TGF-beta signaling pathway
bfo04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    BRAFLDRAFT_213409
   04068 FoxO signaling pathway
    BRAFLDRAFT_213409
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    BRAFLDRAFT_213409
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    BRAFLDRAFT_213409
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     BRAFLDRAFT_213409
Protein kinases [BR:bfo01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   BRAFLDRAFT_213409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 7236745
NCBI-ProteinID: XP_002612985
JGI: 213409
UniProt: C3XSS3
AA seq 373 aa AA seqDB search
VTIIPAILVLVLVIFAAYVLYRRRHPKTPPSSIFGTKLEDGNGNYQIKLDDFDSEVADPS
LENTLNHNEEHLPIKLDTSVGKGRFAEVWKGKLFQESEDRFVTVAVKIFRYDEKQSWQRE
KDIFSDPALKHPNILDFLTAEERGSGIDRQYWLITSYHSNGCLRAYLGRHVLSWEQLCVM
SQTTAAGLAYLHADRATDGAAKMPIAHRDVKSSNVLVKSDGTCCLADFGLALNLDPTIRV
EEYANSGQVGTPRYMAPEALESRVNLVNLESFKQIDVYAMALVLWEMLARCEVTGDVAPY
QPAYADKLSGDHPGIDTMKDVVIRGRERPDIPPGWLVHQGLCRMSEIIEDCWDHDGEARI
TASCAEERINELQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtcaccatcatccccgccatcctggtcctggtccttgtcatctttgccgcgtacgttctc
taccgccggagacacccgaagaccccgccttcgtcaatcttcggcaccaagctcgaggac
ggcaacggcaactaccaaataaaactcgacgacttcgactcggaggtggccgacccaagc
ttggagaacactctgaatcacaatgaggaacacttacccatcaaactggacacctcggtc
gggaagggacgctttgcagaagtctggaagggaaaactgtttcaagaaagcgaggacaga
ttcgtcaccgttgccgttaagatcttccgctacgacgagaagcaatcgtggcaacgtgag
aaggacatcttctcagacccagccttgaagcaccccaacatcttagactttctgacagcc
gaggagagagggagtggtatcgataggcagtactggctcattacgagttaccatagtaac
ggctgtctgagggcgtacctgggacgtcacgtgctgtcatgggaacagctgtgtgtgatg
agtcagacgacagcggcagggctggcctatctgcacgcagacagagccacagacggagcg
gccaagatgccgattgctcacagggatgtgaagagctcgaatgtgctggtgaaaagtgac
ggaacctgctgcctggctgactttgggctggctctcaacttggaccccacaataagggtg
gaagagtacgctaacagtggccaggtgggtacacctaggtacatggcccctgaggcgctg
gagtcccgtgtgaacctggtgaatctggagtccttcaaacagattgacgtgtacgccatg
gcactggtactgtgggagatgctcgccaggtgtgaggtcactggagatgtggccccctac
caacctgcgtacgctgacaagctgagcggtgaccaccctgggatcgacaccatgaaagac
gtggtgattcggggacgagagaggcctgacatcccacctggttggctggtacatcagggg
ctgtgccgaatgtcagagatcatcgaggactgttgggaccacgatggcgaggctcgcatc
accgcgtcgtgcgcagaggagagaataaacgaactacag

DBGET integrated database retrieval system