KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_213409Help
Entry
BRAFLDRAFT_213409 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    BRAFLDRAFT_213409
   04068 FoxO signaling pathway
    BRAFLDRAFT_213409
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    BRAFLDRAFT_213409
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     BRAFLDRAFT_213409
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [Table]
   BRAFLDRAFT_213409
Enzyme-linked receptors [BR:bfo01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   BRAFLDRAFT_213409
Cytokine receptors [BR:bfo04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   BRAFLDRAFT_213409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 373 aa AA seqDB search
VTIIPAILVLVLVIFAAYVLYRRRHPKTPPSSIFGTKLEDGNGNYQIKLDDFDSEVADPS
LENTLNHNEEHLPIKLDTSVGKGRFAEVWKGKLFQESEDRFVTVAVKIFRYDEKQSWQRE
KDIFSDPALKHPNILDFLTAEERGSGIDRQYWLITSYHSNGCLRAYLGRHVLSWEQLCVM
SQTTAAGLAYLHADRATDGAAKMPIAHRDVKSSNVLVKSDGTCCLADFGLALNLDPTIRV
EEYANSGQVGTPRYMAPEALESRVNLVNLESFKQIDVYAMALVLWEMLARCEVTGDVAPY
QPAYADKLSGDHPGIDTMKDVVIRGRERPDIPPGWLVHQGLCRMSEIIEDCWDHDGEARI
TASCAEERINELQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtcaccatcatccccgccatcctggtcctggtccttgtcatctttgccgcgtacgttctc
taccgccggagacacccgaagaccccgccttcgtcaatcttcggcaccaagctcgaggac
ggcaacggcaactaccaaataaaactcgacgacttcgactcggaggtggccgacccaagc
ttggagaacactctgaatcacaatgaggaacacttacccatcaaactggacacctcggtc
gggaagggacgctttgcagaagtctggaagggaaaactgtttcaagaaagcgaggacaga
ttcgtcaccgttgccgttaagatcttccgctacgacgagaagcaatcgtggcaacgtgag
aaggacatcttctcagacccagccttgaagcaccccaacatcttagactttctgacagcc
gaggagagagggagtggtatcgataggcagtactggctcattacgagttaccatagtaac
ggctgtctgagggcgtacctgggacgtcacgtgctgtcatgggaacagctgtgtgtgatg
agtcagacgacagcggcagggctggcctatctgcacgcagacagagccacagacggagcg
gccaagatgccgattgctcacagggatgtgaagagctcgaatgtgctggtgaaaagtgac
ggaacctgctgcctggctgactttgggctggctctcaacttggaccccacaataagggtg
gaagagtacgctaacagtggccaggtgggtacacctaggtacatggcccctgaggcgctg
gagtcccgtgtgaacctggtgaatctggagtccttcaaacagattgacgtgtacgccatg
gcactggtactgtgggagatgctcgccaggtgtgaggtcactggagatgtggccccctac
caacctgcgtacgctgacaagctgagcggtgaccaccctgggatcgacaccatgaaagac
gtggtgattcggggacgagagaggcctgacatcccacctggttggctggtacatcagggg
ctgtgccgaatgtcagagatcatcgaggactgttgggaccacgatggcgaggctcgcatc
accgcgtcgtgcgcagaggagagaataaacgaactacag

DBGET integrated database retrieval system