KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_213833Help
Entry
BRAFLDRAFT_213833 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K13135  gem associated protein 7
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo03013  RNA transport
Module
bfo_M00426  Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BRAFLDRAFT_213833
Spliceosome [BR:bfo03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    BRAFLDRAFT_213833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gemin7
Motif
Other DBs
NCBI-GeneID: 7235752
NCBI-ProteinID: XP_002589141
JGI: 213833
UniProt: C3ZQV6
AA seq 86 aa AA seqDB search
SQDQEDRSFLRERFLHLLKGIQGNRTHCKMYEKTEVDATFQLSDIDGQNFLVSNLETPMG
TQPQAILRCADIISCSVDLGTGEHKI
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
tcacaagaccaggaagacagatcatttctcagagaacgtttcttacaccttcttaagggt
atccagggaaatcggacacactgtaagatgtacgagaagacggaagtcgacgcgacattc
caactgtcagacattgatggtcaaaacttccttgtgtccaatcttgaaacaccaatgggg
acacaaccacaggccatactgaggtgtgctgacatcatttcctgttctgtggacttggga
accggagagcacaaaatttga

DBGET integrated database retrieval system