KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_215113Help
Entry
BRAFLDRAFT_215113 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRAFLDRAFT_215113
Enzymes [BR:bfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     BRAFLDRAFT_215113
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BRAFLDRAFT_215113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 221 aa AA seqDB search
MSTKEQRLLDYVRGHSKSGHPLSVLEAFDAFSNDLEWTMHVGETKGVVLDQAIRDLQPKV
CLELGTYCGYSAIRTARQLRIEGARVLCVECCQEYADVTRETVRHAGLDKKIKVIVGNSS
QVIPQLKKKYGTMKVDFVFLDHVESLYTTDLKLLERHDLLSTGSVILADNVLHPGAPDFL
KYVRGSPRYECSFHPATVRVEGNTVQDGLMKAVYYHRRLSV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagtactaaggaacagcggctactcgactacgttaggggtcacagtaaaagtggacat
cctcttagcgtcctggaagcatttgacgcgttttcaaatgacttagaatggactatgcat
gtcggagaaacaaaaggtgtcgtgcttgatcaggcgatacgagacctccaaccaaaagtg
tgcttagaactaggaacgtactgcggctactccgccatccgcacggccagacagctgcgg
atagaaggcgcacgagtactctgcgtggaatgctgtcaggagtatgctgacgtcaccagg
gagactgtaagacatgcagggctagataagaagataaaggtgatcgtaggcaactccagt
caagtcatcccccagctgaagaaaaaatacggcaccatgaaagtcgactttgtctttctg
gaccacgtagagtccttatacacaacggatctgaaactactagaaagacatgatctcttg
tcaacgggatctgtgatcctggctgacaacgtgctgcacccaggcgctcctgacttcctt
aagtacgtccgcggctctcctcgctacgagtgctccttccacccggccacggtacgggtc
gagggcaacaccgtccaggacggcctgatgaaggcggtgtactaccatcgacgtttaagt
gtgtga

DBGET integrated database retrieval system