KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_215529Help
Entry
BRAFLDRAFT_215529 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bfo00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 537 aa AA seqDB search
YNTSLDDSDKMELLWQVDYEASTVIFQLRADTDANGFAFGMSDDGTLRKADLVVFWTKGN
SVNVADSWTDDHGYFHVDKSQDYHLIDYTANAGKTSVTFSRRFDTCDQQDYRIDSGTTNL
LYVLPEYDISAVSDLNNGYARVRVGTKRQQLLKTETDAPPLPPDVRSFDIRVNQAKIPPE
ETTYWCRTQPLPTLPAKVHVLQYEPIIVPGNEAVVHHMTVFLCGNDVSSTAGYDGPCEGE
EDRRELKTCKHVIAAWAMGAQAFAYPEEAGIPLGGPSASTFAMIEIHYNNPGRRKDIVDS
SGVRFHYTPTLRRHDAGIMELGLRYLPSMAIPPRQDSYVIMGFCPAQCTVKGLPAGGIQV
FASQLHTHLAGSAAVARRRMKHLIKQFLASVIFFVYILQEIRPLRRRVMVLPGDVLMTSC
KYNTADRRSVTMGGYGIHDEMCLNYIHYYPASPIQACKSVVAASALGRFFDVVFRYTGSN
TVCPFMDLNALAQVKDDFSHMPWNPLTTAYLTSLYRRGPIDVMCQKTTGEIFEVKAE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
tacaacacatctctggacgacagcgacaaaatggagctcctgtggcaggtagactacgaa
gcatccacggtgatatttcagctccgtgcggatacagacgcgaacggcttcgcgttcggc
atgtccgatgacgggacgttacggaaggcggacctcgtggtgttctggaccaagggaaac
tctgtcaatgttgcggactcttggacagatgatcatgggtattttcacgttgataagagt
caggactatcatctgattgactacacagccaacgcagggaaaaccagcgtaacattcagt
cgtcgattcgacacctgcgaccaacaagactaccgcatcgactcaggaacaaccaacttg
ctgtacgtcttacccgaatacgacatctctgctgtatccgatctgaataacggctacgcg
cgcgtgcgtgtcggaaccaaacggcagcagttgttgaagaccgagacggacgcccctccg
cttccaccggatgtgaggtcattcgacatccgggtgaatcaggcaaagatcccaccagaa
gagacaacttattggtgcagaactcagccactcccgacactccctgcgaaggttcacgtt
cttcagtacgagcccatcattgtccctgggaacgaggctgtggtacatcacatgaccgtg
ttcctgtgtgggaacgacgtgagtagtacagccgggtacgacggtccgtgtgagggggag
gaagatcggcgggaactcaagacctgcaaacacgtgatcgctgcatgggccatgggtgca
caggcatttgcctacccagaggaggctggaatccctctaggcggtccgagtgcttctacg
tttgccatgatagaaatccactacaacaacccagggcgacgaaaggatattgtggacagc
tcgggcgtcagattccactacacgccgacgctacgacgtcatgacgcaggtatcatggag
ctgggcttacgttacctgccgtccatggcgataccaccacgtcaggatagttacgtcatc
atggggttctgtcccgcacagtgtacggtcaagggcctccccgcaggtggcattcaggtg
ttcgcttcgcagctacacacgcacctggcagggtcagctgcggtcgcaagaaggcgcatg
aaacatttgataaaacaatttttagccagcgttattttttttgtctatattttacaggag
atacgaccattacgacgaagggtaatggtactaccgggtgatgtcctcatgaccagctgt
aaatacaacaccgcagaccgccgcagtgttactatgggtgggtacggtatccatgacgag
atgtgtctgaactacatccattactaccccgcctcgccgatacaggcctgtaagagtgtg
gtggcagcttcggctttgggcaggttcttcgacgtggtgttcaggtacacaggaagcaat
actgtatgccctttcatggatctgaatgcgcttgcgcaggtcaaagacgacttttctcac
atgccatggaacccattgacaacagcttatctgacgtcactctaccgacgcggaccaata
gacgtcatgtgccagaaaactactggtgaaatttttgaggtaaaggcagaataa

DBGET integrated database retrieval system