KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_215529Help
Entry
BRAFLDRAFT_215529 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRAFLDRAFT_215529
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     BRAFLDRAFT_215529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 537 aa AA seqDB search
YNTSLDDSDKMELLWQVDYEASTVIFQLRADTDANGFAFGMSDDGTLRKADLVVFWTKGN
SVNVADSWTDDHGYFHVDKSQDYHLIDYTANAGKTSVTFSRRFDTCDQQDYRIDSGTTNL
LYVLPEYDISAVSDLNNGYARVRVGTKRQQLLKTETDAPPLPPDVRSFDIRVNQAKIPPE
ETTYWCRTQPLPTLPAKVHVLQYEPIIVPGNEAVVHHMTVFLCGNDVSSTAGYDGPCEGE
EDRRELKTCKHVIAAWAMGAQAFAYPEEAGIPLGGPSASTFAMIEIHYNNPGRRKDIVDS
SGVRFHYTPTLRRHDAGIMELGLRYLPSMAIPPRQDSYVIMGFCPAQCTVKGLPAGGIQV
FASQLHTHLAGSAAVARRRMKHLIKQFLASVIFFVYILQEIRPLRRRVMVLPGDVLMTSC
KYNTADRRSVTMGGYGIHDEMCLNYIHYYPASPIQACKSVVAASALGRFFDVVFRYTGSN
TVCPFMDLNALAQVKDDFSHMPWNPLTTAYLTSLYRRGPIDVMCQKTTGEIFEVKAE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
tacaacacatctctggacgacagcgacaaaatggagctcctgtggcaggtagactacgaa
gcatccacggtgatatttcagctccgtgcggatacagacgcgaacggcttcgcgttcggc
atgtccgatgacgggacgttacggaaggcggacctcgtggtgttctggaccaagggaaac
tctgtcaatgttgcggactcttggacagatgatcatgggtattttcacgttgataagagt
caggactatcatctgattgactacacagccaacgcagggaaaaccagcgtaacattcagt
cgtcgattcgacacctgcgaccaacaagactaccgcatcgactcaggaacaaccaacttg
ctgtacgtcttacccgaatacgacatctctgctgtatccgatctgaataacggctacgcg
cgcgtgcgtgtcggaaccaaacggcagcagttgttgaagaccgagacggacgcccctccg
cttccaccggatgtgaggtcattcgacatccgggtgaatcaggcaaagatcccaccagaa
gagacaacttattggtgcagaactcagccactcccgacactccctgcgaaggttcacgtt
cttcagtacgagcccatcattgtccctgggaacgaggctgtggtacatcacatgaccgtg
ttcctgtgtgggaacgacgtgagtagtacagccgggtacgacggtccgtgtgagggggag
gaagatcggcgggaactcaagacctgcaaacacgtgatcgctgcatgggccatgggtgca
caggcatttgcctacccagaggaggctggaatccctctaggcggtccgagtgcttctacg
tttgccatgatagaaatccactacaacaacccagggcgacgaaaggatattgtggacagc
tcgggcgtcagattccactacacgccgacgctacgacgtcatgacgcaggtatcatggag
ctgggcttacgttacctgccgtccatggcgataccaccacgtcaggatagttacgtcatc
atggggttctgtcccgcacagtgtacggtcaagggcctccccgcaggtggcattcaggtg
ttcgcttcgcagctacacacgcacctggcagggtcagctgcggtcgcaagaaggcgcatg
aaacatttgataaaacaatttttagccagcgttattttttttgtctatattttacaggag
atacgaccattacgacgaagggtaatggtactaccgggtgatgtcctcatgaccagctgt
aaatacaacaccgcagaccgccgcagtgttactatgggtgggtacggtatccatgacgag
atgtgtctgaactacatccattactaccccgcctcgccgatacaggcctgtaagagtgtg
gtggcagcttcggctttgggcaggttcttcgacgtggtgttcaggtacacaggaagcaat
actgtatgccctttcatggatctgaatgcgcttgcgcaggtcaaagacgacttttctcac
atgccatggaacccattgacaacagcttatctgacgtcactctaccgacgcggaccaata
gacgtcatgtgccagaaaactactggtgaaatttttgaggtaaaggcagaataa

DBGET integrated database retrieval system