KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_217608Help
Entry
BRAFLDRAFT_217608 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     BRAFLDRAFT_217608
Protein kinases [BR:bfo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   BRAFLDRAFT_217608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 246 aa AA seqDB search
FSPMAAQPFVIRISVQEGEEVDWAVESLQLSFRDVLDVIGRILPDVTTTAFEYEDEDGDR
ITVRSDEEMQAMMSYYVNQISEMQAIGGEVMPLVIYPRACKPAGKRNIHGLTVSSGVFSQ
RYIHVLLKLNLQTLVVMKQSGDLRQILASGEINEDDIQYLAILGHGNGGTVYKANHKSSS
KLMAVKVIPLDVTPEVQKQIMSELEILYRCDSPHIIGFYGAFFTENRISICTEFMDGEFV
VYFLSQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttttctccgatggctgcccagccctttgtcatcagaatcagcgtccaagaaggggaagag
gtagactgggccgtggagtccttacagctgtcttttcgggacgttttggatgtcatagga
agaattctaccggatgtgactaccacagcatttgaatatgaggatgaagacggggacaga
atcaccgttcggagcgatgaggagatgcaggctatgatgtcatattatgtcaatcaaatc
agtgaaatgcaggccattgggggagaggtgatgccacttgtcatctatcccagagcttgt
aagccggctgggaaaagaaatatccatgggttaactgtaagttctggtgtcttctcacag
agatacatacacgtacttctgaagttgaacctccaaactttggtggttatgaagcagtct
ggagatcttagacaaattctggccagtggagagataaatgaagatgatatacagtacctg
gccattctgggacatgggaatgggggcacggtctacaaggcaaaccacaaatccagtagc
aaactgatggcagtgaaggtgattcctttagatgtcactccagaagtacagaagcaaatc
atgtcagagctggaaattttgtacaggtgcgactctccgcacattataggattttacgga
gccttcttcacagagaacagaatttccatatgtacagagtttatggatggtgagtttgtt
gtatatttcttaagtcaataa

DBGET integrated database retrieval system