KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_219176Help
Entry
BRAFLDRAFT_219176 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:bfo04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bfo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 385 aa AA seqDB search
MRCLLFHHFCRSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELRMLCFFKHDNVLSALD
ILQPPPLNFFEEIYVVTELLQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILH
RDIKPGNLLVNSNCILKICDFGLARTEEPDEYKHMTQEVVTQYYRSPELLMGTKHYSQSI
DVWSVGCIFAELLGRRILFQAQSPIQQLELITDLLGTPSLEDMRTACDGAKAHMLRQAHK
PPALASLYTLSSQATHEAVHLLCRMLVFNPDKRISCADALTHPYLDEGRLRYHTCMCKCC
YNTPQGRQYTSDFEPISRQLFDCTWEDSLHSVHMVKEELHRFIGERQRGNKVPLCINPQS
AAFKSFATSSVAQPAELPPSPVAWE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgccttctctttcaccacttctgcaggtctgtaacagaccctcgagacggaaag
cgagtggccctcaagaagatgcccaatgtcttccaaaacctagtatcctgcaagcgcgtc
ttcagggaacttagaatgctctgcttcttcaagcatgacaatgtcttgtcagcactggac
atcttgcaacctcctcctctcaacttcttcgaagaaatttatgtagttactgaactgctc
cagagtgacctgcacaagatcatcgtctccccgcagcccctcagctccgatcatgtcaag
gtcttcctgtaccagatactcagaggtctgaagtacctccactctgcaggcatcttacac
agggacatcaagcctgggaacctgctggtcaacagtaactgtattcttaagatttgcgac
tttgggctggcgcggacggaggagcccgacgagtacaagcacatgacgcaggaggtcgtg
acccagtactaccgctcgcccgagctcctgatggggaccaaacactacagccagtccatc
gatgtttggtcggtggggtgcatcttcgccgagctgctgggacgacgcatcctgttccaa
gcacagagtcccatccagcagctggagctgatcacagacttgctggggactccgtcgttg
gaagacatgaggactgcttgtgacggagccaaggcccacatgcttcggcaggcccacaag
ccgccggccctggcctccctgtacaccctgtccagtcaggccacccacgaagctgtgcac
ctcctctgtaggatgctggtcttcaacccagacaagcgtatatcgtgtgccgacgccctg
acccacccgtacctggacgagggacgtctgcgctaccacacatgcatgtgcaaatgctgc
tataacacccctcaggggcgccagtatacctcagacttcgagcctatctctcgccagctg
tttgactgcacatgggaggacagcctgcactccgtacatatggtcaaagaggaactgcac
aggttcataggtgaacgacaacgtggaaacaaggtgcctctgtgtatcaacccccaatca
gcagccttcaagagttttgccacgtcctcagttgcccagccggcagaacttccgccatca
ccagtagcctgggagtga

DBGET integrated database retrieval system