KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_219190Help
Entry
BRAFLDRAFT_219190 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    BRAFLDRAFT_219190
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BRAFLDRAFT_219190
Protein phosphatases and associated proteins [BR:bfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     BRAFLDRAFT_219190
Transcription machinery [BR:bfo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     BRAFLDRAFT_219190
Spliceosome [BR:bfo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    BRAFLDRAFT_219190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 311 aa AA seqDB search
VRGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEY
GGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD
ECKRRYTIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ
GLLCDLLWSDPDKDVMGWGENDRGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFF
AKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYGGLNAGRPVTPP
RGQNKNKKGKA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gttcgtggctcaagaccgggaaagaatgtgcagttgacagagaatgagatccgtggcttg
tgtctgaagtcgcgggaaatcttcctgagccagcccatcctcctggagttggaggcccca
ctcaagatttgtggtgacattcatggtcagtactatgacttgctgcgtctcttcgagtac
ggaggtttccctcccgagagcaactacctgttcctgggggactacgtggaccgtgggaaa
cagtcgctggagaccatctgtttgctgctagcgtacaagatcaagtatccggagaacttc
ttcctgctcagaggcaaccacgaatgtgcgagcatcaatcgcatctacggattttacgac
gagtgtaaaagaaggtacacaataaaactatggaagacgtttacggactgtttcaactgc
ctgcccatcgcagccatcatagatgagaagatcttctgttgccacggaggactgtcccct
gatttgcaatccatggaacagattcgccgcatcatgcggccgacggacgttccagaccag
ggcctgctgtgcgacttgttgtggtcggaccccgacaaggacgtgatgggatggggggag
aacgaccgtggcgtttccttcacgttcggccccgaggtggtggccaaattcctacacaaa
catgacctggatctcatatgcagagcacatcaggtggttgaagatgggtatgagttcttc
gccaagcgacagctggtcacgttgttctcagcccccaactactgcggggagtttgacaac
gcaggcgccatgatgagcgtagacgagacactgatgtgctctttccagatccttaaacct
gctgacaagaagaagttcccctatggtggcttgaacgcaggccggcctgtgacgccgccc
cgcggccagaacaaaaacaaaaagggcaaagcatag

DBGET integrated database retrieval system