KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_219190Help
Entry
BRAFLDRAFT_219190 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:bfo03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 311 aa AA seqDB search
VRGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEY
GGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD
ECKRRYTIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ
GLLCDLLWSDPDKDVMGWGENDRGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFF
AKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYGGLNAGRPVTPP
RGQNKNKKGKA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gttcgtggctcaagaccgggaaagaatgtgcagttgacagagaatgagatccgtggcttg
tgtctgaagtcgcgggaaatcttcctgagccagcccatcctcctggagttggaggcccca
ctcaagatttgtggtgacattcatggtcagtactatgacttgctgcgtctcttcgagtac
ggaggtttccctcccgagagcaactacctgttcctgggggactacgtggaccgtgggaaa
cagtcgctggagaccatctgtttgctgctagcgtacaagatcaagtatccggagaacttc
ttcctgctcagaggcaaccacgaatgtgcgagcatcaatcgcatctacggattttacgac
gagtgtaaaagaaggtacacaataaaactatggaagacgtttacggactgtttcaactgc
ctgcccatcgcagccatcatagatgagaagatcttctgttgccacggaggactgtcccct
gatttgcaatccatggaacagattcgccgcatcatgcggccgacggacgttccagaccag
ggcctgctgtgcgacttgttgtggtcggaccccgacaaggacgtgatgggatggggggag
aacgaccgtggcgtttccttcacgttcggccccgaggtggtggccaaattcctacacaaa
catgacctggatctcatatgcagagcacatcaggtggttgaagatgggtatgagttcttc
gccaagcgacagctggtcacgttgttctcagcccccaactactgcggggagtttgacaac
gcaggcgccatgatgagcgtagacgagacactgatgtgctctttccagatccttaaacct
gctgacaagaagaagttcccctatggtggcttgaacgcaggccggcctgtgacgccgccc
cgcggccagaacaaaaacaaaaagggcaaagcatag

DBGET integrated database retrieval system