KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_219427Help
Entry
BRAFLDRAFT_219427 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BRAFLDRAFT_219427
Translation factors [BR:bfo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    BRAFLDRAFT_219427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 237 aa AA seqDB search
SSDADDFEPAAPGISAGTDKWEGEDEDDDVKDNWDDEDDNDEKKDQAEKVTAVQKKKKRT
MAEIIREKEEKKKREIEERKAREEAVSMSPEMTPEERAADKLRRQKLAEEGDLELAKDMF
GVDSETGGKIDRMQPQTREDFEEFQKALVEKVSQYQGSIHFVTFLEELFRDCCLGLEAED
VRRLGTTLTVLSNEKAKAAKAAKGGKKGKKQASSLKAVKKVDLEDYSTYGDEYDDFM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
tcttcagacgcagacgactttgagcctgcagcccccggcatcagcgcggggacggacaaa
tgggagggtgaagacgaggatgacgatgtgaaggacaactgggatgatgaagacgataat
gatgaaaagaaagatcaagctgaaaaagttacagctgtccaaaagaagaagaaaagaacc
atggcagaaattataagagagaaagaagaaaagaagaagagagaaattgaagagagaaaa
gccagagaagaagctgtaagtatgtctccagaaatgacaccagaagagcgagcagcagac
aagttgagacgacagaaacttgcagaagaaggagatttagagctagcaaaggacatgttt
ggagtggacagtgaaacaggcgggaagattgacagaatgcagccccaaacgagagaagac
tttgaggagttccagaaggcgctggtggagaaagtgagccagtaccagggttccattcac
ttcgtcacctttctggaggaattatttagggactgctgtttaggattggaggctgaggat
gtcaggaggttaggaactacccttactgttctctccaacgagaaggcaaaagctgcaaag
gcagcaaaaggagggaagaagggaaagaagcaagcatcaagcctgaaggcagtcaagaag
gtggatctggaagactacagcacttacggggatgaatatgatgactttatgtag

DBGET integrated database retrieval system