KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_220053Help
Entry
BRAFLDRAFT_220053 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bfo00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:bfo00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfo00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:bfo00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bfo00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:bfo00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:bfo00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:bfo00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 513 aa AA seqDB search
MGFLTPRSSAEKVLLVPPPVGDSHWMAMAKIGRALVDKGHTVAVVIPQDLMVKRRAEWPD
FQFEAFQDQGTHVRLKEIQEKGLSTAGKLSIFEFANLFYAMSGDLMKHCSLLLGDSKLEH
QLRASQYSVVISDPIFPCGAILSAHLDIRVPHIAVLRGDIYFLDEKATGVPIPLSYVPSI
VTDLTDDMTFGQRVQNVIVSTLLPSVAQSIVSSAFDGLVRTFVGEEETIQSVTSRTDLWL
YQTDDVLDFPRPSMPNMVQVGGLNVGEAAPLTKDMEAFVQSSGDDGVIVVSFGSMVKTMS
TERLEVFASSFARLRQKVVWRYVGEKPTGLGNNTRLLALLPQNDLLAHPKTRAFITHAGS
NGMYEALHHGVPMVCLPLFSDQPANAARVVARGLGVKLDFSTVTSDQLYQAILHVVTNTS
YQETAARLSRLDHDQPQSPMERAVWWIEHVIKHGRLPHLRARAVELPWYQYYLLDVAAFL
LTVCAAVLGTVWYSCSFICGKICCKSGAKLKSQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcacacccagaagcagcgcagagaaggttctgctggtacctccgccagtt
ggtgacagccattggatggctatggccaaaattggtcgtgctttggtggataaaggtcat
acggtcgcggtcgtgatcccacaggacttaatggttaaacgccgggcagagtggcccgac
tttcagtttgaggcattccaagaccaaggaacccacgtaaggctcaaggaaatacaagaa
aaaggtttatctacggctgggaaattgtctatctttgagtttgcaaatctattctacgct
atgtcaggagatttaatgaaacactgttctctacttctgggtgacagtaagctggaacat
caacttagagcatcccagtacagtgtggtgatttccgaccccatttttccttgcggcgct
atcctctcagcccatctagacatccgagtccctcacatcgccgttttgcgtggagatatt
tacttccttgacgaaaaagctacaggtgtaccgattcctctgtcgtacgtaccatctata
gttaccgacttaaccgatgatatgacctttggacaacgagttcagaacgttatcgtatct
actcttctaccatcggtggcacagtctattgtgagtagcgcttttgacggactggtccgt
accttcgtcggtgaggaggaaactattcagagcgtgacgtcacgtacggacttgtggctc
tatcaaaccgacgatgtgctggattttcctcgtcccagcatgcccaacatggttcaagtt
ggaggactgaatgtcggtgaagcagccccccttaccaaggacatggaagcgtttgtccag
agctctggagacgatggagtgattgtcgtcagtttcgggtcgatggtcaagacgatgtct
acagagaggcttgaagtctttgcatcatccttcgcccgactccggcagaaggtggtgtgg
cggtacgtgggagagaagccgaccggtctgggcaacaacaccagactacttgccttgctg
cctcagaacgacttgctggcccacccaaagacccgagccttcatcactcacgctgggtcg
aacggcatgtacgaggccctgcaccacggcgtgcccatggtctgtctgccgctgttctcg
gatcagcccgctaacgccgcccgggtggtggccaggggcctgggggtgaagttggacttc
agcacggtcacctccgaccagttgtaccaggccattcttcatgtcgtcaccaacacaagc
taccaagagacggcagcccgcctgtcccgcctggaccatgaccagccccagtcacccatg
gagcgggccgtctggtggatagaacatgtcatcaaacatggccgcctgccccatctccgc
gcacgcgccgtggagctgccgtggtaccagtactacctgctggacgtggccgcgttcctg
ctgaccgtctgtgcagctgtcctgggtaccgtgtggtacagctgttcgttcatctgtggg
aagatttgctgcaaaagtggcgccaagctgaagtctcagtag

DBGET integrated database retrieval system