KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_220053Help
Entry
BRAFLDRAFT_220053 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00040  Pentose and glucuronate interconversions
bfo00053  Ascorbate and aldarate metabolism
bfo00830  Retinol metabolism
bfo00860  Porphyrin and chlorophyll metabolism
bfo00980  Metabolism of xenobiotics by cytochrome P450
bfo00982  Drug metabolism - cytochrome P450
bfo00983  Drug metabolism - other enzymes
bfo01100  Metabolic pathways
Module
bfo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BRAFLDRAFT_220053
   00053 Ascorbate and aldarate metabolism
    BRAFLDRAFT_220053
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    BRAFLDRAFT_220053
   00860 Porphyrin and chlorophyll metabolism
    BRAFLDRAFT_220053
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    BRAFLDRAFT_220053
   00982 Drug metabolism - cytochrome P450
    BRAFLDRAFT_220053
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_220053
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     BRAFLDRAFT_220053
Glycosyltransferases [BR:bfo01003]
 Others
  Hydrophobic molecule
   BRAFLDRAFT_220053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_2 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 7217926
NCBI-ProteinID: XP_002603542
JGI: 220053
UniProt: C3YJF4
AA seq 513 aa AA seqDB search
MGFLTPRSSAEKVLLVPPPVGDSHWMAMAKIGRALVDKGHTVAVVIPQDLMVKRRAEWPD
FQFEAFQDQGTHVRLKEIQEKGLSTAGKLSIFEFANLFYAMSGDLMKHCSLLLGDSKLEH
QLRASQYSVVISDPIFPCGAILSAHLDIRVPHIAVLRGDIYFLDEKATGVPIPLSYVPSI
VTDLTDDMTFGQRVQNVIVSTLLPSVAQSIVSSAFDGLVRTFVGEEETIQSVTSRTDLWL
YQTDDVLDFPRPSMPNMVQVGGLNVGEAAPLTKDMEAFVQSSGDDGVIVVSFGSMVKTMS
TERLEVFASSFARLRQKVVWRYVGEKPTGLGNNTRLLALLPQNDLLAHPKTRAFITHAGS
NGMYEALHHGVPMVCLPLFSDQPANAARVVARGLGVKLDFSTVTSDQLYQAILHVVTNTS
YQETAARLSRLDHDQPQSPMERAVWWIEHVIKHGRLPHLRARAVELPWYQYYLLDVAAFL
LTVCAAVLGTVWYSCSFICGKICCKSGAKLKSQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcacacccagaagcagcgcagagaaggttctgctggtacctccgccagtt
ggtgacagccattggatggctatggccaaaattggtcgtgctttggtggataaaggtcat
acggtcgcggtcgtgatcccacaggacttaatggttaaacgccgggcagagtggcccgac
tttcagtttgaggcattccaagaccaaggaacccacgtaaggctcaaggaaatacaagaa
aaaggtttatctacggctgggaaattgtctatctttgagtttgcaaatctattctacgct
atgtcaggagatttaatgaaacactgttctctacttctgggtgacagtaagctggaacat
caacttagagcatcccagtacagtgtggtgatttccgaccccatttttccttgcggcgct
atcctctcagcccatctagacatccgagtccctcacatcgccgttttgcgtggagatatt
tacttccttgacgaaaaagctacaggtgtaccgattcctctgtcgtacgtaccatctata
gttaccgacttaaccgatgatatgacctttggacaacgagttcagaacgttatcgtatct
actcttctaccatcggtggcacagtctattgtgagtagcgcttttgacggactggtccgt
accttcgtcggtgaggaggaaactattcagagcgtgacgtcacgtacggacttgtggctc
tatcaaaccgacgatgtgctggattttcctcgtcccagcatgcccaacatggttcaagtt
ggaggactgaatgtcggtgaagcagccccccttaccaaggacatggaagcgtttgtccag
agctctggagacgatggagtgattgtcgtcagtttcgggtcgatggtcaagacgatgtct
acagagaggcttgaagtctttgcatcatccttcgcccgactccggcagaaggtggtgtgg
cggtacgtgggagagaagccgaccggtctgggcaacaacaccagactacttgccttgctg
cctcagaacgacttgctggcccacccaaagacccgagccttcatcactcacgctgggtcg
aacggcatgtacgaggccctgcaccacggcgtgcccatggtctgtctgccgctgttctcg
gatcagcccgctaacgccgcccgggtggtggccaggggcctgggggtgaagttggacttc
agcacggtcacctccgaccagttgtaccaggccattcttcatgtcgtcaccaacacaagc
taccaagagacggcagcccgcctgtcccgcctggaccatgaccagccccagtcacccatg
gagcgggccgtctggtggatagaacatgtcatcaaacatggccgcctgccccatctccgc
gcacgcgccgtggagctgccgtggtaccagtactacctgctggacgtggccgcgttcctg
ctgaccgtctgtgcagctgtcctgggtaccgtgtggtacagctgttcgttcatctgtggg
aagatttgctgcaaaagtggcgccaagctgaagtctcagtag

DBGET integrated database retrieval system