KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_220603Help
Entry
BRAFLDRAFT_220603 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BRAFLDRAFT_220603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 444 aa AA seqDB search
MSYYGSPPKRHHLGETRCPMPGCDSMGHFTGKFETHWTLSGCPLYHNLTKEECKVRAVDR
ESKQKVREKIKKEVSDDAHMALRNPSPTRSQKEYKEKVKEQRKVKPVISEEQKEKARQHK
KTHENNREPLLEGLTSQYDLELFREAQARAAEDMVEVQQGALFEAGLKTIQFGRFELDTW
YSSPYPEEYARLPKLYICEFCLKYMKSATILRRHMAKCVWRHPPGDEIYRKGSISVFEVD
GQKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADGTGCHVVGYFSKEKNSFLNY
NVSCILTLPQYMRQGFGKMLIDFSYLLTRVEEKTGSPERPLSDLGLISYRSYWKGVLLKY
LHEHKHDREISIKDLSTETGVNPYDIVSTLQAMSMLKYWKGKHIVLKRQDLIDEYLKKQA
SKPPDHKAIDPNSLKWTPPVTTKR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagctactacggctcgccccccaaacggcaccacctgggggagacgcgctgccccatg
ccgggctgcgactccatgggccacttcacagggaagtttgagacccactggactctgtcc
ggctgcccgttgtaccacaacctcaccaaggaggagtgtaaggtccgagcagtggacaga
gaatcaaaacagaaagttcgagagaaaatcaagaaggaggttagcgacgatgcccacatg
gcccttagaaaccctagccccacccggagccagaaggagtacaaggagaaggtcaaggaa
cagcgcaaggtcaagccggtcatctccgaggaacagaaggagaaggccagacaacacaag
aaaacccatgagaacaacagagagccgctgttagaagggctgacgtcacagtacgacctg
gaactgttcagagaagcccaggccagagctgctgaagacatggtggaggttcagcagggg
gcgctgttcgaggcggggctgaagacgatccagttcgggcggttcgagctggacacctgg
tactcgtcgccctaccccgaggagtatgcgcggctgcccaagctctacatctgcgagttc
tgcctcaagtacatgaagagcgccaccatcctcaggaggcacatggccaagtgtgtatgg
agacacccccctggagatgagatctacaggaaaggcagcatctctgtgtttgaggtggac
ggacagaagaacaagatctactgccagaacctgtgtctactagcaaagctgttcctggac
cacaagaccctgtactacgacgtggaacccttcttattctatgtcatgacagaggcagac
ggcacggggtgccatgtggtcggctacttctcaaaggagaagaattccttcctgaactac
aacgtatcctgcatcctgaccctgccccagtacatgcggcaaggcttcggcaagatgctt
atagatttcagctacctcctgacgcgggttgaggagaagacgggatcaccagaacgacct
ctgtccgaccttgggctaattagctacagaagttactggaagggcgttctgctgaaatat
ctacacgagcacaaacatgacagggagatctccatcaaagacctgagtacggagacagga
gtgaacccgtatgacatagtcagcaccctgcaggccatgagcatgctcaagtactggaag
gggaaacacatcgtgctcaagagacaggacttgattgacgagtaccttaagaagcaggcg
agcaagcccccagaccacaaggccatcgaccccaactccctgaagtggactcctcccgtc
actaccaagagatga

DBGET integrated database retrieval system