KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_220780Help
Entry
BRAFLDRAFT_220780 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:bfo01200]
Metabolism; Overview; Fatty acid metabolism [PATH:bfo01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bfo00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bfo00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bfo00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bfo00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bfo00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bfo00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bfo00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:bfo04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 719 aa AA seqDB search
MAECATYGTVAVLQINDPPLNVLGHDVRSQLMSGLQQALQDKAVRSIVIMGKGQTFTAGA
DVKEFGTEKVFWEPTLHSLVEAVSAATKPVVTAIHGTTLGGGVALALASHYRLADSSAKM
GLPEVQLGILPTCGVTQRLPRLVGLQTAVRMVTSGQTLSAQQALTAGLLDKVVPDDLLKK
AVGFARSVDVQGLEARRVSSWTVPDVDRAEDVLDAARKTLVRRSRGAIAPLTGLQAIQAS
LLPFETGMKREAELGRYLWTSWQAAALRYAFFAERAVKRWHIPRNKNVNYRTVEPMDIKS
VGVLGAGTMGIGISISLLQAGLKVVLTEVNKAQLDKGKSYCKFWLKKSNSNTELSGGKPQ
PMQLRATTDYSQLREVDLVIEAVFEDLALKKKVFRQLDAVTNPRTILATNTSGLDIDKIA
AATQRPDKVIGTHFFSPAQVMRLLENIYGRHTSGETIATAMQLGATIGKVGVLVGNCPGF
VGNRMKGLNFTEAMFLLEEGADPQDVDKALEEFGFAMGPFRVSDLAGGDVHWRRRIQAGL
TTEHGPPPYTPVLYRQGNRYSPLADMLCMQGRFGQKTGAGWYRYKSGSRTALPDAEVHRL
IHKHRQDHGFQRRNISSQEIVERCLFPLINEGFRILEEGLAAGPQDIDVIFLLGFGWPRH
TGGPMYYADKVVGLGNLLQSLEKYRAHHPRSAHWVPSSLLRKMAAQGTSLSIWAAGSRL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtgcgccacctatggaacggtagcggtactgcagatcaacgatccgccatta
aacgtcctgggccatgacgtcaggagtcagctgatgtccggcttgcagcaagccttgcag
gacaaagcggtccgcagcattgtcatcatgggcaaggggcagacctttactgcaggggct
gatgtgaaagagttcgggactgagaaggttttctgggagcctacactgcactctttggtt
gaggccgtgtccgccgcaactaaacctgtggtcactgcaattcacggaaccacgctaggg
ggaggtgttgcactagccttggcctcacactaccggctggcagactcctcagccaagatg
ggactaccggaggtacagctggggatcctgccgacctgcggggtaacacagcggctgccc
cgcctggtgggactacagacggccgttaggatggtcacttctggtcagactctgtcagca
caacaggcacttacagctggcttgctggataaagtagtcccggacgatctgctgaagaag
gctgttggcttcgcgaggtcagtagatgtccaggggcttgaggccagacgggtcagcagc
tggacagtccccgatgtggatcgggcagaagacgtgctagacgcagccaggaagacactt
gtgcgaaggtcccgtggcgctatcgctcctctaacaggtcttcaggcgatccaggcttcc
ctcctaccgtttgagacggggatgaagcgtgaggctgaactaggacggtacttgtggaca
tcctggcaggctgcagcgctgaggtacgcgttctttgcagagagggcagtcaaacgatgg
cacattcccaggaacaagaacgttaactataggactgtggagccaatggacatcaaaagt
gtaggggtgctgggtgcaggtaccatgggtatcggcatctccatcagcctacttcaggca
ggtttgaaggttgttctgactgaagtcaacaaggcacaattggacaaaggtaagtcctac
tgtaaattttggctaaagaagtctaactcaaacactgaactatcaggcggtaaaccgcag
cccatgcagctgagagcgaccacagactacagccagttaagggaggttgatctggtcatt
gaagccgtgttcgaggacctcgctctaaagaagaaggtgtttcggcagctcgacgcagtg
accaacccacggacaatcctggcgaccaacacgtctggactggacatagacaaaattgcg
gcggccacacagcggccagacaaggttatcgggactcacttcttctcccctgctcaagtg
atgcgtttgttggaaaacatctatggaagacacacgtcaggggagaccatcgcaacggcc
atgcaactgggtgctaccattgggaaggtgggggtgctggtcgggaactgtccaggcttt
gtggggaacagaatgaagggtctgaacttcacagaagccatgtttctattggaggaaggg
gcggatccacaggacgtagacaaggcgctggaggagtttggtttcgcgatgggcccgttc
cgtgtgagtgaccttgctggaggagacgtacactggcggagacggatacaggccgggctg
actaccgagcatggtccgcccccatacacacccgtgctttatcggcagggcaaccgctac
tctccactggcagacatgttgtgcatgcaggggcgcttcggacagaaaacgggggcgggc
tggtacaggtacaagtccggcagccgtactgcccttcctgatgctgaagtacatcggctc
atccacaagcaccgtcaggaccatggcttccagaggagaaacatatcatcacaggagatt
gtagaacgttgcttgttcccgctcatcaatgagggtttccgcatcctggaggaaggacta
gctgctggaccacaggacatagatgtcatcttcctcctcggctttggatggccgagacac
acaggaggaccgatgtactacgctgacaaggttgttggtctggggaacctgctacaatct
ctggagaagtaccgagcccaccatccgcgcagtgcacactgggtacccagtagccttctg
cggaagatggctgcccagggtaccagtctttcaatatgggcagcagggagtagactttga

DBGET integrated database retrieval system