KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_224325Help
Entry
BRAFLDRAFT_224325 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BRAFLDRAFT_224325
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BRAFLDRAFT_224325
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_224325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 557 aa AA seqDB search
MAAAGRSWGPLVGAVDQGTSSTRFLIFASNSAELLTYHQTEIHSVLPKEGWVEQDPKEIL
ASVYECIEKAVANTRDLGIDINDIKAIGITNQRETTVVWDKHTGEPLHNAIVWLDLRTAE
TVNRLIESTPRKNKEHLKPLCGLPLATYFSAVKLRWLLDNSEKVAQAVREGRAMFGTVDS
WLLWNLTGGVKGGVHVTDVTNASRTMLLNIHTQQWDTNLCKFFSVPMTILPEIRSSSEIY
GHMVQGVLKGLPISGCLGDQSAALVGQCCFTRGSAKNTYGTGCFLLYNTGTEPIPSEHGL
LTTIAYKLGKDKPTFYALEGSVAIAGECVKWLRDNLGIIQKSSDIEALAATVTDTAGAHF
VPAFSGLFAPYWESDARGIICGLTQFSTKAHIARAALEAVCFQTCEILEAMNKDSRIPLE
SLQVDGGMTQNNLLMQLQADLLGIQVVRPAMPETTALGVAMAAGAAEGVGVWSLDPADLT
SITTDTFTPALSQDERDSRYNKWKYAVQKAMKWEGHTHKEPDSKPTGEDNTVVKSLPAGI
FIFSTAVLLLVTTLCQR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccggccggagttggggtcctcttgttggtgccgtggaccaagggacgagc
agcacacgctttctgatctttgctagtaactctgcagagctgctgacgtaccatcagaca
gagatccactctgttcttcctaaggaaggatgggtggaacaggacccaaaggaaatcctg
gcctcagtgtacgagtgtattgagaaggctgtggccaacaccagggacctgggcatcgat
atcaacgatataaaagccattggcattaccaaccagagagagacaacagtagtgtgggac
aagcacacaggagagccccttcacaatgccatagtgtggctggacctgcggacagcagaa
acagtcaacaggttgattgagagcacaccacggaagaacaaagaacaccttaagccgtta
tgtggcctgcccctggccacctacttcagtgctgtgaagctgcgttggctgctggacaac
agtgagaaggtggcgcaggcagtcagggagggcagggccatgtttgggacggtcgactcc
tggctactctggaacttgacaggaggagtgaagggaggtgtccatgtgacagatgtgacc
aacgccagcagaaccatgctgctgaatatacacactcaacagtgggacacaaacctgtgc
aagttcttctccgttcccatgacgatccttcctgagatcaggagttcgtctgagatctac
ggccacatggtgcagggagtgctgaaaggcctacctatctctgggtgtctgggtgaccag
tcagcagccctggttggacagtgctgcttcacaagggggagtgccaaaaatacatacggc
acagggtgtttcctgttgtacaacactggcacagagcctatcccatcagagcatggactg
ctgacaaccatcgcatacaaactgggcaaggacaagccaactttctatgcactggagggt
tccgtggccattgcaggagagtgtgtaaagtggctgagagacaacctgggcatcatccaa
aagtcttccgacatagaggcccttgctgccacggtgacagacacagcaggggctcacttt
gtaccagccttctctgggctgtttgctccgtattgggagtctgacgccagaggtatcatc
tgtggcctgacccagttctccaccaaggctcacatcgccagggctgcgctggaggcagtc
tgtttccagacctgcgagattcttgaagcgatgaacaaggattcccgtatcccccttgag
agcctccaggtggatgggggcatgactcagaacaacctcctgatgcagctacaggctgat
ctgctgggcatacaagtcgtccgtcctgccatgccggagaccacagccctgggcgttgcc
atggcagcgggcgcggctgaaggtgtgggtgtgtggagcctggacccagctgacctgacc
tccatcactactgacaccttcactcctgcactgtctcaggatgagcgtgacagccggtac
aataagtggaagtacgccgtccagaaagccatgaagtgggaggggcacacgcacaaggaa
cctgacagcaaacctacaggtgaggacaacacagtagtcaaaagtcttccagcaggcatc
ttcatattcagcacagctgttctcttactggtcaccaccttatgtcagagatag

DBGET integrated database retrieval system