KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_225095Help
Entry
BRAFLDRAFT_225095 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06013  
STE24 endopeptidase [EC:3.4.24.84]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Terpenoid backbone biosynthesis
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bfo00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 354 aa AA seqDB search
QILQSVTFVLLGTVFSTVTGLPWGLYSTFVIEDRHGFNKQTLGFYFKDLAKKFVVTQLIS
LPVAAGLLYIIKAGGDYFFVYAWLFTFVVTMGLIFIYADYIAPLFDRFTPLPDGDLRTQI
ETLAASIDFPLYKIFVVEGSKRSSHSNAYFFGFYKNKRIVLFDTLLEENPVNKEAAAGET
AGDGSSEDSSDTAREKKKKIGCSNEEILAVLGHELGHWKLGHNLKNIIISQVNTFLCFFL
FALLSNWKELYAAFGFPDSQPALIGLLIIFQFIFSPYNELLSFLMTVLSRRFEFQADTFA
LGLNKGADLCTALIKLNKDNLGFPVHDWLYAAWHYSHPGLLERLRALDYKQKEQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
cagattctgcagtcagtaacatttgtactgttaggtactgtgtttagtactgtaacagga
ctgccatggggtttatactctacatttgtcatagaggacagacatggcttcaacaaacag
acccttgggttctactttaaggaccttgctaagaagtttgtggtgacccagctgatctcg
ctgcccgtggccgcaggtctgctctacatcatcaaggcaggaggagactacttcttcgtc
tacgcctggctcttcaccttcgtcgttaccatgggcctgatcttcatctatgcagactac
attgctccgctgtttgatcgcttcacgcccctccctgatggagacctacggacacagatt
gagaccctggcagctagcattgactttcctctctacaaaatctttgttgtggaaggttcc
aagcgatcctcccacagcaatgcctacttcttcggcttctacaagaacaagaggatcgtg
ctgtttgacaccctgctggaggagaaccctgtaaacaaggaggcagcagctggggagact
gccggggacgggtcatctgaggacagctcggacactgccagggagaagaagaagaagatt
ggctgcagcaatgaggagatcctggccgtgttaggccacgagctgggtcactggaaactg
ggccataatctcaagaacatcattatcagccaggtgaacacattcctgtgtttcttcctg
tttgccctgctgagtaactggaaggagctgtacgcagcgttcggcttccccgactcccag
ccggccctcatcggcctcctcatcatattccagttcatcttctccccttataatgagctg
ctatccttcctgatgaccgtcctgagtcgcaggttcgagttccaggccgacaccttcgcc
ctgggtctgaacaagggagccgacctctgcacggcgctcatcaaactcaacaaggacaac
ctggggttcccggtacacgactggttatacgctgcctggcactactcccacccaggcctc
ctggagagactacgggcgctggactacaaacagaaggagcagtaa

DBGET integrated database retrieval system