KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_225095Help
Entry
BRAFLDRAFT_225095 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K06013  
STE24 endopeptidase [EC:3.4.24.84]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRAFLDRAFT_225095
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.84  Ste24 endopeptidase
     BRAFLDRAFT_225095
Peptidases [BR:bfo01002]
 Metallo Peptidases
  Family M48: Ste24 endopeptidase family
   BRAFLDRAFT_225095
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_225095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 354 aa AA seqDB search
QILQSVTFVLLGTVFSTVTGLPWGLYSTFVIEDRHGFNKQTLGFYFKDLAKKFVVTQLIS
LPVAAGLLYIIKAGGDYFFVYAWLFTFVVTMGLIFIYADYIAPLFDRFTPLPDGDLRTQI
ETLAASIDFPLYKIFVVEGSKRSSHSNAYFFGFYKNKRIVLFDTLLEENPVNKEAAAGET
AGDGSSEDSSDTAREKKKKIGCSNEEILAVLGHELGHWKLGHNLKNIIISQVNTFLCFFL
FALLSNWKELYAAFGFPDSQPALIGLLIIFQFIFSPYNELLSFLMTVLSRRFEFQADTFA
LGLNKGADLCTALIKLNKDNLGFPVHDWLYAAWHYSHPGLLERLRALDYKQKEQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
cagattctgcagtcagtaacatttgtactgttaggtactgtgtttagtactgtaacagga
ctgccatggggtttatactctacatttgtcatagaggacagacatggcttcaacaaacag
acccttgggttctactttaaggaccttgctaagaagtttgtggtgacccagctgatctcg
ctgcccgtggccgcaggtctgctctacatcatcaaggcaggaggagactacttcttcgtc
tacgcctggctcttcaccttcgtcgttaccatgggcctgatcttcatctatgcagactac
attgctccgctgtttgatcgcttcacgcccctccctgatggagacctacggacacagatt
gagaccctggcagctagcattgactttcctctctacaaaatctttgttgtggaaggttcc
aagcgatcctcccacagcaatgcctacttcttcggcttctacaagaacaagaggatcgtg
ctgtttgacaccctgctggaggagaaccctgtaaacaaggaggcagcagctggggagact
gccggggacgggtcatctgaggacagctcggacactgccagggagaagaagaagaagatt
ggctgcagcaatgaggagatcctggccgtgttaggccacgagctgggtcactggaaactg
ggccataatctcaagaacatcattatcagccaggtgaacacattcctgtgtttcttcctg
tttgccctgctgagtaactggaaggagctgtacgcagcgttcggcttccccgactcccag
ccggccctcatcggcctcctcatcatattccagttcatcttctccccttataatgagctg
ctatccttcctgatgaccgtcctgagtcgcaggttcgagttccaggccgacaccttcgcc
ctgggtctgaacaagggagccgacctctgcacggcgctcatcaaactcaacaaggacaac
ctggggttcccggtacacgactggttatacgctgcctggcactactcccacccaggcctc
ctggagagactacgggcgctggactacaaacagaaggagcagtaa

DBGET integrated database retrieval system